KEGG   Vitis vinifera (wine grape): 100256536Help
Entry
100256536         CDS       T01084                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00630  Glyoxylate and dicarboxylate metabolism
vvi00710  Carbon fixation in photosynthetic organisms
vvi01100  Metabolic pathways
vvi01200  Carbon metabolism
Module
vvi_M00165  Reductive pentose phosphate cycle (Calvin cycle)
vvi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
vvi_M00532  Photorespiration
vvi_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    100256536
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100256536
Enzymes [BR:vvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     100256536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small Swm2
Motif
Other DBs
NCBI-GeneID: 100256536
NCBI-ProteinID: XP_002270117
UniProt: D7SQB3
LinkDB All DBs
Position
11
AA seq 169 aa AA seqDB search
MAAGILSGPVTSFGYVGLKPHQPKLFPAKDSVAWSRKTVSNGSKTHCMKTWNPINNKKFE
TLSYLPPLSDDSIAKEIDYMLKKGWIPCLEFDEVGYVFRKNSQIPGYYDGRYWTLWKLPM
FGCNDASQVLNEIHECKKTYPNAYIRCLAFDNEHQGQCMAFVIQKPTCS
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcagctggaatcctctcaggtccggtcacaagtttcggctatgttgggttgaagccc
caccagcccaagctgtttccggcaaaggattcggttgcatggagccggaaaactgtgtca
aatggttctaaaactcattgcatgaagacatggaatccaatcaataacaagaagtttgag
acgctctcttatcttcctcctctctctgatgactcgattgcaaaggagatagactacatg
ctcaaaaagggttggatcccttgccttgaatttgacgaagtgggatatgtatttaggaag
aacagccagattccaggctactacgacgggaggtattggacattgtggaagctgccaatg
ttcgggtgcaatgatgcctctcaagtcctgaatgagattcatgagtgcaagaaaacgtac
ccaaatgcttatatccgctgcttggcatttgacaatgagcaccagggtcagtgcatggcc
tttgtcattcaaaaacccacctgcagctaa

DBGET integrated database retrieval system