KEGG   Vulpes vulpes (red fox): 112914895
Entry
112914895         CDS       T05911                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04010  MAPK signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04640  Hematopoietic cell lineage
vvp04916  Melanogenesis
vvp05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112914895 (KITLG)
   04014 Ras signaling pathway
    112914895 (KITLG)
   04015 Rap1 signaling pathway
    112914895 (KITLG)
   04072 Phospholipase D signaling pathway
    112914895 (KITLG)
   04151 PI3K-Akt signaling pathway
    112914895 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112914895 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    112914895 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112914895 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:vvp04052]
    112914895 (KITLG)
Cytokines and growth factors [BR:vvp04052]
 Growth factors
  Growth factors (RTK binding)
   112914895 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 112914895
NCBI-ProteinID: XP_025847986
UniProt: A0A3Q7S0A7
LinkDB
Position
Unknown
AA seq 274 aa
MKKAQTWIITCIYLQLLLFNPLVKTKGICGKRVTDDVKDVTKLVANLPKDYKIALKYVPG
MDILPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSF
ENVKKALKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKVSNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKK
KQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaaggcacaaacttggattatcacttgcatttatcttcagctgctcctgtttaat
cctctggtcaaaactaaagggatctgcgggaaacgtgtgactgatgatgtgaaggacgtt
acaaaattggtggcaaatcttccaaaagactataagatagccctcaaatatgtccccggg
atggatattttgcctagtcattgttggataagcgtgatggtggaacagttgtcagtcagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcctgagtaattattctatc
atagacaaacttgtgaaaatagtggatgatcttgtggagtgcacagaaggatactcattt
gagaatgtaaaaaaagcacttaagagcccagaactcaggctttttactcctgaagaattc
tttagaatttttaatagatccatcgatgcctttaaggacttggagacggtggcatctaaa
agtagtgaatgtgtggtttcttcaaccttaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggtctcaaattccattggagactccaacttacaatgggcagccatggca
ttgccagcattcttttctcttgtaattgggtttgcttttggagccttatactggaagaag
aaacaaccaaatctcacaaggacagttgaaaatatacagattaatgaagaggataatgaa
ataagtatgttgcaagagaaggagagggagtttcaagaggtgtaa

DBGET integrated database retrieval system