KEGG   Vulpes vulpes (red fox): 112916127
Entry
112916127         CDS       T05911                                 

Gene name
EIF4EBP1
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp03013  RNA transport
vvp04012  ErbB signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04211  Longevity regulating pathway
vvp04218  Cellular senescence
vvp04910  Insulin signaling pathway
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05221  Acute myeloid leukemia
vvp05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    112916127 (EIF4EBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112916127 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    112916127 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    112916127 (EIF4EBP1)
   04152 AMPK signaling pathway
    112916127 (EIF4EBP1)
   04150 mTOR signaling pathway
    112916127 (EIF4EBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112916127 (EIF4EBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112916127 (EIF4EBP1)
  09149 Aging
   04211 Longevity regulating pathway
    112916127 (EIF4EBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    112916127 (EIF4EBP1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    112916127 (EIF4EBP1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112916127 (EIF4EBP1)
   05163 Human cytomegalovirus infection
    112916127 (EIF4EBP1)
   05165 Human papillomavirus infection
    112916127 (EIF4EBP1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112916127 (EIF4EBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112916127 (EIF4EBP1)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     112916127 (EIF4EBP1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 112916127
NCBI-ProteinID: XP_025849382
UniProt: A0A3Q7RTF3
LinkDB
Position
Unknown
AA seq 118 aa
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPASEEPPTEPSQNHLRNSPEDKPAGGEESQFEMDI
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtccggaggcagcagctgcagccagaccccgagccgggccatccccgccactcgccgg
gtggtcctcggcgacggcgtgcagctgccgcccggggactacagcaccacccccggcggc
acgctcttcagcaccaccccgggaggtaccaggatcatctatgaccggaagttcttgatg
gagtgtcggaactcgcctgtgaccaaaacacccccgcgggacctgcccaccattcccggg
gttaccagccctgccagtgaggagcccccaacagagcccagccagaaccacctgcgcaac
agcccggaagataagccagccggtggtgaagagtcacagtttgagatggacatttaa

DBGET integrated database retrieval system