KEGG   Vulpes vulpes (red fox): 112919310
Entry
112919310         CDS       T05911                                 

Gene name
SERPINB5
Definition
(RefSeq) serpin B5 isoform X1
  KO
K10139  serpin B5
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
vvp05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112919310 (SERPINB5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112919310 (SERPINB5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vvp01002]
    112919310 (SERPINB5)
Peptidases and inhibitors [BR:vvp01002]
 Peptidase inhibitors
  Family I4: serpin family
   112919310 (SERPINB5)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 112919310
NCBI-ProteinID: XP_025853498
UniProt: A0A3Q7SBP5
LinkDB
Position
Unknown
AA seq 387 aa
MECGLELTLRPTMDALRLANSAFAVDLFKQLCEKEPEGNVLFSPICLSTSLSLAQVGAKG
DTANEIGQVLHFENIKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNPSTEFISST
KRPYAKEMETVDFKDKLEETKGQINQSIKDLTDGRFENILADNSVSDQTKILVVNAAYFV
GKWMKKFPESETKECPFRINKTDTKPVQMMSMEATFCMGNVDGINCKVIELPFQNKHLSM
LILLPKDVEDESTGLEKVEQQLNSETLLQWTNPSTMANAKVKLSIPKFKVEKIIDPKASL
ENLGLKNIFNENTSDFSGMSETKGVALSNVIHRVCLEITEDGGDSIEVPGSRILQHKDEF
NADHPFIYIIRHNKTRNIIFFGKFCSP
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggagtgtggcttagaattgactctgaggcccacaatggatgctctacgattggcaaat
tcagcttttgcagttgaccttttcaaacaactgtgtgaaaaggagccagagggcaatgtc
ctcttctctccaatctgtctctccacctctctgtcacttgctcaagtaggtgccaaaggt
gacacagcaaatgaaattggacaggtccttcattttgaaaatatcaaagatgtacccttt
ggatttcaaacagtgacatcggatgtaaacaaactcagttccttttactcgttgaaacta
atcaaacggctctacgtggacaaatctctgaatccttccacagagttcatcagctctacg
aagagaccctatgccaaggaaatggaaaccgttgacttcaaagataaattggaagagaca
aaaggtcagatcaaccagtcaatcaaggatctcacggatggccgctttgagaacatcttg
gccgacaacagtgtcagcgaccagacaaagatcctcgtggtgaatgctgcctacttcgtt
gggaagtggatgaagaagtttcctgaatccgaaaccaaagaatgcccgtttaggatcaac
aagacggacaccaaaccagtgcagatgatgagtatggaggccacgttctgtatgggcaac
gttgatggtatcaattgtaaggtcatagagcttcccttccaaaataagcacctgagcatg
ctcattctgctacccaaggatgtggaggatgaatccacaggcctggagaaggttgaacaa
cagctcaactctgagacgctcttgcagtggaccaatcccagcaccatggccaacgccaaa
gtcaaactctccattcccaagtttaaggtggaaaagataattgatcccaaagctagtctg
gaaaacctagggctgaaaaatatctttaatgagaatacatctgatttctctggaatgtca
gagaccaagggagtggctctctccaatgttattcacagagtatgcttagagataactgaa
gatggtggggattccatagaggtgccaggatcacgaatccttcaacacaaggatgaattc
aatgccgaccacccatttatttacatcatcaggcacaacaaaacgcgaaacatcattttc
tttggcaagttctgttctccttaa

DBGET integrated database retrieval system