KEGG   Vibrio vulnificus CMCP6: VV2_0256
Entry
VV2_0256          CDS       T00108                                 

Definition
(GenBank) glycosidase
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00052  Galactose metabolism
vvu00500  Starch and sucrose metabolism
vvu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    VV2_0256
   00500 Starch and sucrose metabolism
    VV2_0256
Enzymes [BR:vvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     VV2_0256
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase Alpha-amylase_C Cyc-maltodext_C
Other DBs
NCBI-ProteinID: AAO07222
UniProt: A0A3Q0KXL2
LinkDB
Position
II:complement(282444..284078)
AA seq 544 aa
MENKWWHDAVVYQIYPRSFCDSNNDGIGDLNGIISKLDYLKTLGVNVLWLSPVYKSPMDD
NGYDISDYQDIAAEFGTMADMQNLLAQAKARDIRIVMDLVVNHTSDEHPWFVEARKSRDN
PYRDYYIWRDAKPDGSVPDDQGSIFGGSAWQWDEATQQYYFHLFSKRQPDLNWENPKVQQ
EVHKMMNWWIDQGIGGFRLDVIDLIGKEIDKGITGNGPRLHPLLQEMNRATFGDKDLLTV
GETWGATPEIAKLYSDPERHELSMVFQFEHITLTWQHGDKWNPIPLDLKQFKHVLTKWQT
ELSNQGWNSLFWNNHDLPRVVSKYGDDQRYRVESAKMLATALHFLKGTPYIYQGEEIGMT
NVAFESLEQYKDIETLNFYKVKTESGVSHQHMMDAIHENSRDNARTPMQWSASQNGGFSQ
AKPWIEVNPNYPEINVEQALADSDSIFYHYQKLIELRKQHPAIVYGDFTPLFAEHDSVFA
YVRSHQDEQLLVINNFSDQDISLALPDNLQNKEVNCLIYNYDSLCMLGVTLSLKPYQCYA
FKLR
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggaaaacaaatggtggcacgatgcggtggtctatcaaatctacccgcgtagtttttgc
gactcaaacaacgacggcatcggtgatttaaatggcatcatcagcaaactcgattacctg
aaaacacttggcgtaaacgtgctttggctctcgcccgtgtataagtcgcctatggacgac
aacggctacgacatttctgattatcaagatatcgctgcggaatttggcaccatggccgat
atgcaaaacttacttgctcaagcaaaagcacgtgatatccgcatcgtaatggatcttgtt
gtcaaccatacctcagatgaacacccttggtttgtagaagcgcgtaaatcgagagacaac
ccttatcgtgactactatatttggcgtgatgcgaaaccagatggcagtgtgcccgatgac
caaggctcgatttttggaggcagtgcttggcaatgggatgaagcaacacaacagtattac
ttccatctattttctaagcgacagccggatctcaattgggagaatcctaaagtccagcag
gaagtacacaagatgatgaactggtggattgaccaaggcatcggtggatttaggctcgac
gttatcgacttgattggcaaagagatcgacaaaggtattactggtaatggcccaaggctg
catccactattgcaggaaatgaacagagcgacgtttggcgacaaagatctgctgaccgtt
ggcgaaacatggggagcaaccccagaaattgcaaaattgtatagcgatcctgagcgtcat
gaactctccatggtgttccaatttgagcacatcacgctcacttggcaacacggtgacaaa
tggaaccctattcctcttgatctcaaacaattcaaacacgtactgaccaagtggcaaacc
gagttatcgaaccaaggttggaactcgttgttttggaacaatcacgatttaccacgagta
gtctcgaaatacggtgatgaccaacgttatcgtgttgagtcagcgaaaatgctggcaacg
gcgttgcatttcctcaaaggcacgccttacatctaccaaggtgaagagatcggtatgacc
aatgtcgcgtttgagtcgttagagcaatacaaagacattgaaacgctgaacttctacaaa
gtgaaaacagaatcaggggtgtcacatcaacatatgatggacgcgatacatgagaacagc
cgtgacaatgctcgcaccccaatgcagtggtccgcatctcagaatggtggctttagtcag
gcgaaaccttggattgaagtgaatccgaactatccagagatcaacgtggaacaagcattg
gcagattcagattccattttctatcactaccaaaagctgattgaactgcgcaaacagcac
ccagcgatcgtctatggcgatttcaccccactgtttgcagagcacgatagtgtgtttgcc
tatgtccgctcacatcaagatgagcagctgctggtcatcaacaactttagtgatcaagat
atttcattagcgttgccggataacttgcaaaacaaagaagttaactgcctgatttataac
tacgattcgttgtgcatgctcggagtgacattgtcactaaaaccgtatcagtgctacgca
tttaaacttagataa

DBGET integrated database retrieval system