KEGG   Vibrio vulnificus YJ016: VV2406
Entry
VV2406            CDS       T00150                                 

Definition
(GenBank) signal transduction histidine kinase
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VV2406
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvy01001]
    VV2406
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vvy02022]
    VV2406
Enzymes [BR:vvy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     VV2406
Protein kinases [BR:vvy01001]
 Histidine kinases
  OmpR family
   VV2406
Two-component system [BR:vvy02022]
 OmpR family
  RstB-RstA
   VV2406
SSDB
Motif
Pfam: HATPase_c HisKA HATPase_c_3 HATPase_c_2 Phosphonate-bd HAMP HATPase_c_5 HVSL
Other DBs
NCBI-ProteinID: BAC95170
UniProt: Q7MIV7
LinkDB
Position
I:2435907..2437541
AA seq 544 aa
MCLFLGGFNMIRAFAILWLAVFVPTTLLIIPSGVNPVLKLNEQFSEDFYKPIYRVNFEVL
SNKLLQQPTTQWQQTIDHYAKSFAYPVKLQPLADYQADNTIYASLQQGQVTFLYADPMAL
LQRVGDSDQVLYIALNESTEHAVLNQAKGTLSLAIEDLRQLPKSEWKNTLAQTNAKLPVH
ISLTNETQLSETAKLALLNSPDEIVSYINDEGRVELLAPIDDGLWLHVQDNLSQAVQLKL
STTIALMFFLLISLALILWVYPLWRDLTRLVATATEFGQGKLSQRARASKLSVVSQLSDS
FNNMADNIESLIARQRELTNAVAHDLRTPLYRLRFAIEMLEDPHTSDAQKEKYQRALHTS
IDDLDHLINQNLLLSRYNRIADITHFSPCCFARELLNEIDDFKLQHPELDIQFYCSPELK
QHRMFIDNKGLMRAVKNLLTNASRFAQSTIIVSFKYSGSAFHITVEDDGQGVPNEHAERI
FEPFTQLDNQARSSEKGHGLGLAIVKQIMLWHKGNAKVVSSTLGGAAFELQWPELHPNTA
ESEL
NT seq 1635 nt   +upstreamnt  +downstreamnt
gtgtgcctcttcttgggaggtttcaatatgattcgcgcatttgccatcttatggttggcg
gtgtttgtaccgactactttgttgatcatccccagtggggtaaacccggttttaaaactc
aacgagcagttttccgaagatttctataagccgatctatcgggtgaactttgaggtgttg
tccaacaaactcttgcagcaacccacgactcagtggcaacaaacgatcgaccactatgcc
aaaagctttgcctatcctgtaaagctccaaccgttggcagactaccaagccgacaacacc
atctatgcttcactacaacaaggccaagtaacgtttctttatgccgacccaatggcgctc
ttacaacgagttggcgacagtgaccaagtgctgtatatcgctcttaacgaatccaccgag
catgcagtgctcaatcaggccaagggtacactttcattagcgattgaagatctgcgtcaa
ctgcctaaaagtgagtggaaaaacacgctagcacaaaccaacgccaaactccctgtccac
attagtttgaccaacgaaacgcaacttagcgagactgccaagctcgctttgttgaactcc
cccgacgagattgttagttatatcaatgatgagggacgcgtcgagctacttgcccccatc
gatgatggcttgtggttacacgtccaagataacttatcgcaagccgtacaactcaagttg
agcaccaccatcgcgctgatgttcttcctactgatttcgcttgctttgattttgtgggtt
tatccactttggcgtgatttaactcgactggtggcaaccgccaccgaatttggccaaggc
aaactgtcacaacgggcgcgagcttccaagctctcggtggtttctcaactcagtgactcc
ttcaacaacatggccgacaatatcgagagtctcattgctcggcagcgtgagctgaccaac
gccgtcgcacacgatttacgtacgccattgtatcggctgcgctttgcgattgagatgctg
gaagatcctcacaccagcgacgcgcaaaaagagaaatatcaacgcgcactgcacacaagc
attgatgatctcgaccatctcatcaatcagaatttactgctctctcgctacaatcggatt
gccgatatcacccatttttcaccatgttgctttgctagggagttgctcaatgaaatcgat
gatttcaaacttcagcatcccgaactcgatatccagttttactgctcgccagagttaaaa
cagcaccgcatgttcatcgacaacaaaggattgatgcgcgcggtgaaaaaccttcttacc
aatgcaagccgatttgctcaaagtaccattattgtctcgtttaaatacagtggcagcgca
tttcacattacggtggaagacgatggccaaggtgtgcccaatgaacacgcagaacgcatt
tttgaacctttcactcagcttgataaccaagcacgcagtagcgaaaaaggacatgggtta
ggattggcgatcgttaaacaaatcatgctttggcacaaaggcaacgcgaaagtggtgtca
tcgactttgggtggtgcagcgtttgaactgcagtggcctgagctgcatccgaatactgcc
gagtcggaattgtga

DBGET integrated database retrieval system