KEGG   Vibrio vulnificus YJ016: VV2824
Entry
VV2824            CDS       T00150                                 

Definition
(GenBank) GGDEF family protein
  KO
K20961  diguanylate cyclase [EC:2.7.7.65]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    VV2824
Enzymes [BR:vvy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VV2824
SSDB
Motif
Pfam: GGDEF HAMP DUF1449
Other DBs
NCBI-ProteinID: BAC95588
UniProt: Q7MHP5
LinkDB
Position
I:complement(2885092..2886363)
AA seq 423 aa
MPQFMNNLPRHSLANRLLRFVSICAIVYLVLLLALMIPFGFKNAQQAHTELEQKLVLSLS
NSAAIALYVNNHEIAEEVIDSLLLHDEINAVRLESLEGVTFDKIKPGQFEKDMWLHANQY
PLLSPVDAKPLGILYVHDNHLVIQRKTLDKVLYQILFVLLQFLMTFVVIALVVKRIIGKP
LRALSIAVSRATPGQVKTVEVDDINRNNEIGLVANSINTFIENSHQALIREKELRSQIER
WEIYYRGMAEQDTLTGLKNRLGCEKHFSHMKHSEAYLSLLLIDLDGFKAVNDSHGHAVGD
AVLSTIANRYLHLTQEHFNQSVVGRIGGDEFVIYLPHRDGPEKMEAFLLAFAEQLIESSN
TPIEVKQLQVHVGCSIGIATATAAKADMEKLLLQADNAMYLAKQDGKNTARFFRRPVSQS
VGN
NT seq 1272 nt   +upstreamnt  +downstreamnt
ttgccacaatttatgaataacttgccgagacattcattagcgaatcgcctgctgagattt
gtttcgatatgcgcgattgtctatctagtgcttttgctggcgctgatgattccgtttggc
tttaaaaatgcgcagcaagcacatacggagttagaacaaaaattggtgttgtctctctct
aactcggcggccatcgcgttgtatgtcaataaccatgagattgccgaagaggtgattgac
tctttgctgctgcatgatgaaatcaatgctgtgcgtcttgaaagtttagagggcgtgacg
tttgacaaaatcaaaccggggcagtttgaaaaagacatgtggctgcacgcgaatcaatac
cctttactctcaccagtggatgccaaaccgttaggaattctgtatgtgcacgacaatcat
ttggtgattcaacgtaaaaccctcgacaaagtgctttaccagattttgtttgttttgctg
cagtttttgatgacgtttgtggtcattgcgttggtggtaaaacgcatcatcggtaagcca
ttgagggcgctctcgattgcggtgtcgcgtgccactccaggacaggtgaaaaccgttgaa
gtggatgatatcaatcgcaacaacgaaatcggtttggtggccaatagcatcaacaccttt
attgaaaactcgcatcaggcactgatccgagagaaagagctacgctctcagattgaacgc
tgggaaatctactaccgtggtatggcggagcaagacaccttaactggtctcaaaaaccgt
ttgggctgtgaaaaacacttttcacacatgaaacacagtgaggcttatttatcactgtta
ctcattgatttagatggttttaaagcagtcaatgacagccatgggcatgcagtgggtgat
gccgtgttatccaccatcgcgaatcgttaccttcatctgacccaagagcattttaatcaa
agtgtcgttgggcggattggtggggatgagtttgtcatttacttgccacatcgtgatggg
ccagaaaaaatggaagcctttttgttggcgtttgctgagcagttaattgagtcgagcaat
acgccgattgaagtgaaacaactgcaagtacatgtcggttgcagtatcggcattgcgacg
gcaacggccgcaaaagccgatatggagaagttgctgcttcaagctgataatgcaatgtac
cttgccaaacaggatggaaaaaacactgcgcgtttttttcgccgaccggttagccagtcg
gtaggtaactga

DBGET integrated database retrieval system