KEGG   Xenorhabdus bovienii CS03: XBW1_3731
Entry
XBW1_3731         CDS       T03845                                 

Definition
(GenBank) putative Indoleacetate--lysine synthetase
  KO
K03397  indoleacetate---lysine synthetase [EC:6.3.2.20]
Organism
xbv  Xenorhabdus bovienii CS03
Brite
KEGG Orthology (KO) [BR:xbv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XBW1_3731
Enzymes [BR:xbv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.20  indoleacetate---lysine synthetase
     XBW1_3731
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-ProteinID: CDM91087
UniProt: A0A0B6XB46
LinkDB
Position
complement(3561545..3562708)
AA seq 387 aa
MRIFQSERERLATITQCYFSDYQEFCSIVPVNKQILLPVNTPIEAASFPALIGTTSGTTG
TMKAVRTAFKVSKNSASNSEHNLISRLKKQQVFTCQDVVGNLFTINLFSSLHYSACEIAK
YCHASVIPIGDIKLLDKKHFHFLVKIGLSVLFGVPASIIQFIEAMKYFDISLSIKKIVFT
GESLRKDQKKYILDILGNDVKIIGLYGLSECGFLGVSTENHDQYILFKEDFFFEYDNKFG
LLVTSLDQTASYRLIRYPTGDNAKISYKNESLLLTDIRRNIDEFNFMGNVVNCKKLTRLI
VNQLPDAQIQITLSSDNQNKECLMIRVSSKENDKADLVSLEEEIRNIPELVEVYSRKRGN
VCLIKTDYNDFSLSPRGKHLLIIDNRS
NT seq 1164 nt   +upstreamnt  +downstreamnt
ttgcgtatattccagagtgaacgggaacgtctggcaacaataacacaatgctatttttct
gattatcaagaattttgcagtatagtgcctgtaaacaagcaaatacttttacctgtgaat
acaccgatagaagcggcttcttttcctgccttgataggcacaaccagcggaactacagga
acaatgaaggctgtacggactgctttcaaagtgagcaaaaattcagcttccaatagtgaa
cataatcttattagcaggctaaaaaaacaacaagtttttacttgccaggacgtagtaggt
aatctgtttacgattaatttattctcatcattacactactctgcctgtgaaatagcaaaa
tactgtcatgccagcgtaattccaattggagatattaaactcttagataaaaaacatttt
cattttctcgtaaaaattggtctttctgtattatttggtgtgcctgcctcaattattcaa
tttattgaggcaatgaagtattttgatatttcattatcaataaaaaagatagttttcact
ggtgaatctcttcgaaaagaccagaaaaaatatattcttgatatattagggaatgatgta
aaaattattggactgtatgggttgtctgagtgtggttttctgggagtttctactgagaat
catgatcaatatattctctttaaagaggacttcttttttgaatatgataataagtttggg
ttattagttacttcattggatcaaacagcatcatatcgtttgatccgataccctactggt
gataatgcaaaaatcagttataaaaatgagagtctgctattaactgatatcaggcgtaat
atagatgaatttaatttcatggggaatgttgtcaattgtaaaaaactaacacgccttatt
gtcaatcaattacccgatgctcaaatacaaattacattatcttctgataatcagaataaa
gaatgtctcatgataagagtttcatctaaagaaaatgataaagctgatttagttagccta
gaagaagaaatacgaaatataccagagttagttgaagtttatagtagaaagcgaggaaat
gtctgtttaattaaaacagactataacgacttttctctatctccacgaggaaagcatttg
ttaatcatagataatcggagttaa

DBGET integrated database retrieval system