KEGG   Xanthomonas citri pv. citri NT17: J169_02563Help
Entry
J169_02563        CDS       T03734                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xcn  Xanthomonas citri pv. citri NT17
Pathway
xcn00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xcn00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    J169_02563
Enzymes [BR:xcn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     J169_02563
Transporters [BR:xcn02000]
 Other Transporters
  Pores ion channels [TC:1]
   J169_02563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AJY91368
UniProt: A0A0U5FIJ3
LinkDB All DBs
Position
complement(2789660..2790358)
Genome map
AA seq 232 aa AA seqDB search
MITVHHLNNSRSQRVLWLLEELALPYQIVRHERDPKTMLAPPALRAIHPLGKSPVLVDGD
LVVAESGAILEYLTERYDTECALSPSPRPLDSPERLQFRYWMHYAEGSAMPPLLMTLIFG
RIRSAPMPFFAKPIARAIVDKAMSGFVGPQLTLHLNWMEQSLQAGNWFAGERFTAADIQM
SFPVQAAAARGGGLEKYPRLHAFLERIQARPAYQAALKKGGPFELMGSKPAK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgttcaccatctcaataattcccgttcccagcgcgtgctgtggctgctggaa
gaactggcgctgccttatcagattgtgcgccatgagcgcgaccccaagaccatgctggcg
ccgccggcactgcgcgcgatccatccgctgggcaagtcgccggtgctcgtcgatggcgat
ctggtggtggccgagtcgggggcgatcctggaatacctgaccgagcgctacgacaccgag
tgcgcactgtcgccgtcgccgcggccgctggattcgcccgagcgcctgcagttccgctat
tggatgcattacgccgaaggctcggcgatgccaccgttgctgatgacgctgatcttcggt
cgcatccgcagcgcgccgatgccgttcttcgccaagcccatcgcgcgtgcgatcgtggac
aaggcgatgtcgggcttcgtcgggccgcagctcaccttgcatctgaactggatggagcag
tcgttgcaggccggcaactggttcgctggcgaacgctttaccgccgccgacatccagatg
agcttcccggtacaggccgctgctgcacgcggcggcggtctggagaaatacccgcgtctg
cacgcgtttctggaacggatccaggcgcgtccggcgtatcaggctgcgctgaagaagggc
ggcccgttcgaactgatgggaagcaagccggccaaatga

DBGET integrated database retrieval system