KEGG   Xiphophorus couchianus (Monterrey platyfish): 114136425
Entry
114136425         CDS       T05908                                 

Gene name
cul1
Definition
(RefSeq) cullin-1
  KO
K03347  cullin 1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04110  Cell cycle
xco04114  Oocyte meiosis
xco04120  Ubiquitin mediated proteolysis
xco04141  Protein processing in endoplasmic reticulum
xco04310  Wnt signaling pathway
xco04340  Hedgehog signaling pathway
xco04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114136425 (cul1)
   04120 Ubiquitin mediated proteolysis
    114136425 (cul1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114136425 (cul1)
   04340 Hedgehog signaling pathway
    114136425 (cul1)
   04350 TGF-beta signaling pathway
    114136425 (cul1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114136425 (cul1)
   04114 Oocyte meiosis
    114136425 (cul1)
Ubiquitin system [BR:xco04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     114136425 (cul1)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 114136425
NCBI-ProteinID: XP_027860200
LinkDB
Position
21
AA seq 776 aa
MSSSRTQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSS
QTRGPVPPAKPSKKSTTPGGAQFVGLELYKRLKEFLKNYLTSLLKDGEDLMDECVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQVT
NAVLKLIERERNGETINTRLISGVVQSYVELGLNEEDAFAKGPTLSVYKEYFECQFLTDT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRITDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKVYVQTTLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTRMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLSNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYHLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDSYTVQQLTDSTQIKTDILVQVLQILLKSKLLVLEDENANVDE
VEFKPDTVIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtcgtccagccggacccagaacccccacggactgaaacagatcggcctggaccagata
tgggacgacctgcgggcgggcatccagcaggtctacacgcggcagagcatggccaagtcg
cgctacatggagctctacacacatgtctataactactgcaccagcgtccaccagtccagc
cagacccggggccccgtccctccagccaaaccctccaagaagtccaccactccgggcggc
gcgcagttcgtcggcctggaactctacaagcggctcaaggagttcctgaagaactacctg
accagcctgctgaaggacggcgaggacctgatggacgagtgcgtgctgaagttctacacg
cagcagtgggaggactaccgcttctccagcaaggtcctgaacgggatctgcgcctacctc
aaccgccactgggtccggcgggagtgtgacgaggggcggaaaggcatctacgagatctac
tccctggctctggtgacctggagggagtgtttattccgacctctaaacaagcaggtgacg
aacgccgtcctgaagctgatcgagagagagaggaacggcgagaccatcaacacccggctg
atcagtggtgttgtccagtcctacgtggagctgggcctgaacgaggaggacgccttcgcc
aaaggtcccacgctgtccgtctacaaggaatacttcgagtgccagttcctgaccgacacg
gagcgcttttacacgcgcgagagcaccgagttcctgcagcagaacccggtcaccgagtac
atgaagaaggccgaggcccggctgctggaggagcagcgccgcgtccaggtctacctgcac
gagtccacgcaggacgagctggcccgcaagtgtgagcaggttctgatcgagaagcacctg
gagatcttccacaccgagttccagaacctgctggacgccgacaagaacgaagatctgggc
cggatgtacaacctggtgtcgcggatcacggacgggctgggcgagctcaagaagctgctg
gagacccacatccacaaccagggcctggccgccatcgagaagtgtggcgaggcggcgctc
aacgaccccaaagtctacgtccaaaccacgctggacgtccacaagaagtacaacgcgctg
gtcatgtccgccttcaacaacgacgccggcttcgtggccgcgctcgacaaggcgtgcggt
cgcttcatcaacaacaacgccgtcaccaggatggcccagtcctccagcaaatcccccgag
ctgctggcccgatactgcgactccctgctcaagaagagctccaagaacccggaggaggcg
gagcttgaggacacgctgaaccaagtgatggttgtgttcaagtacatcgaggacaaagac
gttttccagaagttttacgccaagatgctggccaagcgcctggttcaccagaacagcgcc
agcgacgacgccgaggccagcatgatctccaagctgaagcaagcgtgtggctttgaatac
acgtccaagctgcagcggatgttccaggacatcggcgtcagcaaagacctcaacgaacag
ttcaagaagcacctcagcaactccgagccgctggacctggacttcagcatccaggtgctg
agctccgggtcctggccgttccagcagtcctgcaccttcgctctgccttcagagctggag
cggagctaccagcgcttcacggcgttctacgccagcaggcacagcggcaggaagctcacc
tggctctaccacctgtccaaaggagagctggtcaccaactgcttcaagaacaggtacacc
ctgcaggcctccaccttccagatggccatcctgctgcagtacaacacggaggacagctac
acggtgcagcagctgaccgacagcacgcagatcaaaaccgacatcctggttcaggttctg
cagatcctgttgaagtccaagctgctggttctggaggacgagaacgccaacgtggacgag
gtggagttcaaaccggacacggtcatcaagctgttcctgggatacaagaacaagaagctg
agggtgaacatcaacgtgccgatgaagacggagcagaagcaagagcaggagacgacccac
aagaacatcgaggaggaccggaagctcctgatccaggccgccatagtgaggatcatgaag
atgaggaaggttctgaagcaccagcagctcctggctgaagtcctgaaccagctgtcgtcc
cggttcaaacccagagttcccgtcatcaagaaatgcatcgacatcctgatagagaaggag
tacctggagcgagtggacggagagaaggacacctacagctacctggcctga

DBGET integrated database retrieval system