KEGG   Xiphophorus couchianus (Monterrey platyfish): 114143615
Entry
114143615         CDS       T05908                                 

Gene name
kif7
Definition
(RefSeq) kinesin-like protein KIF7
  KO
K18806  kinesin family member 7
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114143615 (kif7)
Cytoskeleton proteins [BR:xco04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     114143615 (kif7)
SSDB
Motif
Pfam: Kinesin Microtub_bd ANAPC5
Other DBs
NCBI-GeneID: 114143615
NCBI-ProteinID: XP_027871620
LinkDB
Position
4
AA seq 1347 aa
MSPKVPAGQGREDYSAVQVAVRVRPLLPKELLHCHESCITVDPELNRVTLGHDRHFVCDF
LFEETCCQEEVYSASVQPLIDAFFQGFNATVFAYGQTGSGKTYTIGEANISSFRDEEQGI
IPRAVADVFKLLDENDLTDFSVRVSYLEVYKEEFKDLLEVKTASKDIHIREDKGNIVLCG
VKESEVEGLDEVLSLLESGNTARHTGSTQMNPNSSRSHTIFTLHMDQRRGSTRLYATAGS
TGPQVLSSKFHFVDLAGSERILRTGNTGERLKESIQINSGLLALGNVIGALGDPKRKGSH
IPYRDSKITRILKDSLGGNSKTLMIACISPSSSDFDESLNTLNYATRARNIQNRATVNCK
REPDRVEGLEQQIKALRRALENRQRSETRIIAHADPNRRPRVGEAEISRLQAQSAHYRTC
TDTAYRLLGELQSEGTLTAEQSLRVKEWLCSVEEERSGLTTASGPDSGIENSSTEDSVAL
RRARPSIRNQDTEAVEESWDDDQDHEKEESVVHLQSEIQRLEKENTDFLAALEDAMEQYK
QQSDKLQEQQDLITELQYQLSTLGLMGMGLNLRFRPHTAPMGSMQHGQNGNTYRQVSLMG
HIGQVPDQDGKLYEDQEIPGGTESCNREKEANHPNVSQEKCRPVNLTWTKRDLLSGGLKA
PSSQAELDQHPCLARKASNSSSGESLRSFEGISECGLLQAQQKIRELSVTIRMKEELIKE
LVKTGKDAQALNKQYSHKISALESEAVQARQELQEAQRQLQDLEKQEREISTTDKSRAQE
CRRKIAAAQSRVQVLSQRQRDTARLANLPVQSERRVSELERSVQSMKQQQEQLQRRLREE
SQQKRRLETEMQRRTHRVKELEIKNEQQQKILRIKTEEIAAFQRQRRSGSNGSLISLEEQ
QKIEEQKRWLDEEMERVLDQRRALEDLEGELTKREEILAKKEALLQERSGLETKRLRSSQ
ALSKDLVTLTGRIETLEQELSERNGLLRSSSAQDSQHIRQEISNLRHEKDSLLKQRVELD
DKLRKGNLLSPEEERILFQLDEAIEALDAAIEYKNEAITQRQRQLRASASMLSQWEMNLM
AKLSYLSASETRALLCKYFDKVVSLREEERKLQLALAELEMQLDEQQRLVQWLENALDRA
QLDTDRRLTQQQKEHERSMQLLLQQCREQMDEGLAGRRRQYEGQIHNLTKELNHYRTANL
ELSNKLRDVFGSVSQPKELPKVLASDAKPKNLGSRSPEDGAGGRGTGHPDKPSRSREEMR
ELVNTPLPSTWRRSSLPSEEPAVMEELWVQAAGDSPVNRVVQTGMGSWGPQTTLPAVKSR
RESRRSSLNYAQQPSNNVLIDVRKNPV
NT seq 4044 nt   +upstreamnt  +downstreamnt
atgtctcccaaagtccctgccggccaaggcagagaggactattctgccgtccaagttgca
gttcgagttcgtccgctgctgcccaaggagctcctgcactgccatgagagctgcatcacc
gtggaccctgagctgaaccgcgtcaccctgggtcatgatcgccactttgtttgtgacttc
ctgtttgaagagacttgctgtcaggaggaggtttattctgcctccgtccagccgctcata
gatgcattctttcaaggtttcaacgccacagtgtttgcctatggccagacaggctcaggc
aagacttacaccatcggagaagctaatattagttccttcagagatgaggagcagggcatc
attcccagggctgttgctgatgttttcaagctgctcgatgaaaacgacctcacagacttc
tctgtacgagtttcctatttggaggtctacaaagaagagttcaaggacttactggaggtg
aagacggccagcaaggacatccatatccgggaggacaaagggaacattgtattgtgtggc
gtaaaagagagtgaagtagagggtcttgacgaggtgttgagcttgctagagtcaggaaac
acagccagacacaccggatcaacccagatgaatccaaactccagcaggtctcacaccatt
ttcaccttgcatatggatcagcgtcgtggaagcactcgactttatgcgaccgctggaagc
actggaccgcaagtgttatcttccaagttccactttgtagacttggctgggtcagagcgg
atcttaaggactggtaacactggagagagactgaaagaaagcatccaaatcaacagcggc
cttctggctctgggtaacgtcattggggccctcggtgacccaaagaggaaaggctctcat
ataccatatagagactctaaaatcacaaggatactaaaagactctcttggaggaaattca
aaaacactgatgattgcctgcatcagtccgtcatcctcagacttcgacgagagtctgaac
acactgaactatgcaacgagggccagaaacattcaaaaccgagctacggtcaactgcaag
cgcgaaccggatcgtgtggaaggactggagcagcagatcaaagcccttcgaagggctctg
gaaaaccgtcagcgctccgagacacgaatcattgctcacgccgatccaaacaggagacct
agagtcggagaagcagagatcagcaggctgcaagcacaaagcgctcactacaggacttgt
acagacaccgcttacaggttgctgggggagcttcagagcgaggggactttaaccgcagag
cagagtctgagggtgaaggagtggctttgctcggtggaggaggagcggagcggactcaca
accgcctccggaccagacagcggcatcgagaacagctccactgaggacagcgtcgcgttg
agaagagccaggccttctatcaggaatcaggacacagaagctgtggaggagagctgggac
gatgatcaggaccatgagaaagaagagagtgttgttcatcttcagtcggaaatccaacgg
ctggagaaggaaaacactgatttcttagcagcactggaggacgctatggagcaatacaag
cagcagagtgacaagctgcaggagcagcaggacctgataacagagctgcagtaccagctg
tccactctggggctgatgggtatggggctcaacttgagatttagaccacacaccgccccc
atgggctccatgcagcatgggcagaatggaaacacatatagacaggtgagcttgatgggt
catattggacaggttcctgatcaggatggaaaactttatgaggaccaagagattccagga
ggaacagagagctgcaacagggaaaaagaggccaatcatccaaatgtcagccaggagaaa
tgcaggccagtgaacctgacctggaccaagcgggacttgctttcaggaggactgaaggct
ccctcttctcaggctgagctcgatcaacacccatgtttagccagaaaagcatctaattcc
agcagcggggaaagtctcagaagctttgagggaatatcagagtgcggacttcttcaggca
cagcagaagatcagggagctgtctgtcaccatccgcatgaaggaagaactcatcaaggaa
ctggtcaaaacagggaaggatgctcaggccctgaataagcagtacagccataagatctcg
gctctggaaagtgaagctgtgcaggcgcgtcaggagctgcaggaggctcaacgtcagctg
caggatctggagaaacaagagagagaaataagcacaacagacaagagcagagcgcaggaa
tgtcgcaggaagatagctgctgctcagagcagagttcaggtgctcagtcagcggcagagg
gatacggctcgcctggccaaccttcctgtccagagtgagcgccgcgtgtcagagctggag
agaagcgtccagtccatgaagcagcagcaggagcagctgcagaggcgtctgcgtgaggag
agccagcagaaacgccgcctggagactgaaatgcagcgaaggactcacagagtcaaggaa
cttgagataaagaatgagcagcagcagaagatcctgagaataaagacggaggagattgca
gccttccagagacagagacgcagtggaagtaatggatctttgatttcattagaagagcaa
cagaagattgaggaacaaaagcgctggctggatgaggaaatggagcgagttctagatcag
aggagagcgctggaggatctggaaggagaactgacgaaacgagaggaaatcctggccaag
aaagaagctttgctgcaggaacgcagcggcctggagaccaagaggctccgctccagtcag
gccttgagtaaggatttggtgacacttactgggcgcatcgagacactggagcaagagcta
agtgagaggaacggcctccttcgcagcagcagcgctcaggactcccaacatatacgacaa
gagatctccaacctgcggcacgagaaagactcgctgctcaagcagcgtgttgagctggat
gataaactgcggaagggaaacctgctctcacccgaggaggagcggattcttttccagctg
gacgaggcgattgaagctttggacgctgccattgaatacaagaatgaggccatcactcag
aggcagaggcagctcagggcttctgccagcatgctctcccagtgggaaatgaacctcatg
gccaagctcagctatctgtccgcctctgagaccagagctctgctgtgcaaatactttgac
aaggtggtgtctctgcgtgaggaggagcgaaagctgcaactggcgctggccgagctggag
atgcagctggacgagcagcagcggctggtgcagtggctggaaaatgccctcgaccgcgca
cagctcgacacagaccggcggctcacgcagcagcagaaggaacacgagaggagcatgcag
ctgctgctgcagcagtgtcgagaacaaatggacgaaggcctagcaggacggcggcggcag
tacgaaggacagatccataatcttaccaaggaactcaaccactacaggacagcaaatctg
gagcttagcaacaaactgcgagatgtctttggttcagtcagtcagcctaaagagcttccc
aaagtcttagcctctgatgccaaacctaaaaacctgggcagccgaagccctgaggacggt
gctggaggcagagggacaggacatcctgacaaacccagcaggtccagggaggaaatgaga
gaactggtgaacacccctcttccgtccacgtggaggcgctcttctctcccatcagaggag
cctgctgtcatggaggaactgtgggttcaagcagccggagactctcctgttaaccgtgta
gttcagacgggtatggggtcctgggggccgcagaccaccctgcctgctgttaaatcccgc
agagagtctcgtcgctccagcctcaactacgcacaacagccatcaaacaacgttttgatt
gacgtacggaagaatcctgtatga

DBGET integrated database retrieval system