KEGG   Xiphophorus couchianus (Monterrey platyfish): 114147695
Entry
114147695         CDS       T05908                                 

Gene name
gsk3b
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04012  ErbB signaling pathway
xco04110  Cell cycle
xco04150  mTOR signaling pathway
xco04310  Wnt signaling pathway
xco04340  Hedgehog signaling pathway
xco04510  Focal adhesion
xco04910  Insulin signaling pathway
xco04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114147695 (gsk3b)
   04310 Wnt signaling pathway
    114147695 (gsk3b)
   04340 Hedgehog signaling pathway
    114147695 (gsk3b)
   04150 mTOR signaling pathway
    114147695 (gsk3b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114147695 (gsk3b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114147695 (gsk3b)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114147695 (gsk3b)
   04916 Melanogenesis
    114147695 (gsk3b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114147695 (gsk3b)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xco03036]
    114147695 (gsk3b)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     114147695 (gsk3b)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   114147695 (gsk3b)
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    114147695 (gsk3b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1 Choline_kinase
Other DBs
NCBI-GeneID: 114147695
NCBI-ProteinID: XP_027878051
LinkDB
Position
7
AA seq 427 aa
MSGRPRTTSFAESCKPVPQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
DKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPMVYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVSQQVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNIKLPNGREK
PSLFNFTTQELSSNPSLASILIPAHARNQAVASTPTNASATTDGSSTERGPNTTTASASA
SNSTSTS
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgtcgggtcggcccaggaccacatccttcgccgagagctgcaagccagtgccgcagccc
tctgctttcggcagcatgaaagtcagccgagacaaagatggcagcaaggtaacgacagtt
gtggccactcctggccaaggccccgacaggccacaggaggtcagctacacagacacgaag
gttatcggcaacggatcctttggcgtcgtctaccaagcaaaactctgcgactctggggaa
ctagtggcaataaagaaggtcctacaagataagagatttaagaatcgtgagctgcagatc
atgaggaagttggaccactgcaacattgtccgcttgcgctacttcttctactccagtgga
gacaagaaagacgaggtgtatttgaatctggttttggactacgttcctgagaccgtctac
agagtggccagacactacagccgagccaaacagacgctgccaatggtttatgtcaagttg
tacatgtaccagctgttcaggagcctggcttacatccattcgtttgggatctgccatcgg
gacattaagccccagaatctgctgctcgacccagagacggctgttctcaagctctgcgac
tttggcagcgcgaagcagctggtccgtggagagcccaacgtgtcctacatctgctctcgc
tactaccgggccccagagctcatctttggtgccactgactacacctccagcatagatgtg
tggtcagctggctgcgtcctggcagagctgctgttaggacagccaatcttccctggagac
agtggggtggatcagcttgtggaaatcattaaggttctcggtactccaacccgagaacag
atccgcgaaatgaaccccaactacactgagttcaaattcccccagatcaaggcccaccct
tggactaaggtgagtcagcaggtcttccggcctcggacccctccggaggccatcgccctc
tgctctcgcctgctggagtacacgcccactgcgcgcctcacccctctggaggcctgcgct
cactccttctttgatgagctgcgtgaccccaacatcaagctgcccaacggcagagagaag
ccctcgctcttcaacttcaccacccaggagctatctagtaatccctctctggcctccata
ctcatccctgcccacgcccgcaaccaggctgtcgcctcgacaccaaccaacgcgtctgcc
accacagatggcagcagcacggagcgaggtcccaacaccaccaccgcctccgcctcagcc
tccaactccacctccacctcttga

DBGET integrated database retrieval system