KEGG   Xiphophorus couchianus (Monterrey platyfish): 114156358
Entry
114156358         CDS       T05908                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04141  Protein processing in endoplasmic reticulum
xco04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114156358 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114156358 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xco03000]
    114156358 (atf6b)
Transcription factors [BR:xco03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    114156358 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA bZIP_Maf MCU CENP-H PBP_sp32
Other DBs
NCBI-GeneID: 114156358
NCBI-ProteinID: XP_027892536
LinkDB
Position
13
AA seq 716 aa
MTADLLSDLDSRFFADNLLTSEDWDACLFKCESMEEGEDGDFSQGLKYEPSFDNDLVLTL
DPDNRTSPWRYLDDNLLTGNTLVKKNEMTLTEPLPVEMLFQVKAEPPSPASSLDSDCSTL
SPDPQVTIKAENPPTPPYMYGDVLSPPLGTMEVTVATTAVPPPQSQIPIMTQTQLQTPLT
SVQAVINGIPTQTAAVLPSTLKASTILSTKPPIQPRPVCVAATLPVPQNPAPAKTLILQG
LPSMDQNRPVVLSPSVCLSSAPAIVKMEPVSPTIPQHCSSPAASSTSKPIVPATTPLPSN
NSNDIDMKVLKRQQRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRRENQALRE
RLAVKESGDSASNKRAVCVMAVLLFMTFSFGPVSITDRKLSASLQEDLVSYTGRRLLEIE
QQQDRQADPQPLQKIEDKPEKPESGGDERWKGGEAERYAPESYQFRNLSDMFSDLKDLVL
PDIERYFTSSDCRQFNRSESLRLADELRGWVHRHQIDRKKSGGKAKTAKKAKITQKAQLR
KANISRYLPIQAHRSIESQLRVLPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLLPAIS
HNKTSRPKMSLVMPAMSVNESLYNSSQGYEMMMQVDCEVMDTRIIPIKSSAVPPSLREPS
PPPPSSQHGAHHHHGNSTSLRGRHQHHPSSSSPSPRQPLPARTQTPEYLISQSEGV
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgactgcggatttactgtctgatctggacagccgattcttcgctgataaccttttgacg
agcgaagattgggatgcctgcctgttcaagtgtgagagcatggaggaaggagaggacggg
gacttcagtcaagggttgaaatacgaaccatcgtttgacaatgacctcgtgctcaccctc
gatcctgataaccgcacgtcaccatggcgataccttgacgacaaccttctcacaggaaac
actttggtgaaaaaaaatgagatgacattgacagagccgctccctgtggaaatgttgttc
caggtcaaggctgagcctccctctcctgcttcctcgctggactcagattgttcgaccttg
tcgcctgacccacaggttacaattaaagccgaaaaccctccgactcctccgtacatgtat
ggagacgtactgtctcctccgctggggacgatggaggtaaccgtggcaacgacagcagta
cccccaccccagtcccagattccaataatgacacagactcagctgcagacaccattaaca
tctgtccaagcagtcatcaatggaataccgacacaaactgcagcagtcctgccaagcaca
ttaaaagccagcaccatcctgagcaccaaacctcccatccagccccgacccgtgtgtgtt
gctgctacactccccgtcccgcaaaaccctgcaccagcgaagaccctcattctgcagggg
ctcccctccatggatcagaacagacccgttgtcctctctccgtccgtctgtctcagttcg
gctccggctattgtcaaaatggagcccgtgtcccctaccatccctcagcactgctccagc
ccagctgcctcctcaaccagcaagcccatcgtcccggcgaccacgccgttacccagcaac
aactccaacgacattgatatgaaggtgctaaagcggcaacagaggatgataaaaaacaga
gagtctgcctgccagtcaagaaagaaaaagaaggaatacctgcagaacctggaggctcag
ctgagggaagctcagcaggagaacgaacgactccgcagggagaaccaggcgctgagggag
agactggctgtgaaggagagcggcgactctgcaagcaacaagagagcagtgtgtgtcatg
gcggttctgctgttcatgactttcagctttggccccgtcagcatcactgacaggaagctg
tcagctagtctgcaggaagatctggtgtcttatacgggtcgccggctgctggagatcgaa
cagcagcaggatcgccaggctgatcctcaacctctccagaaaattgaggacaaaccggag
aaaccggagtccggcggcgatgagcggtggaagggaggagaggcggagagatacgctcca
gagtcttatcagttccgaaacctgagtgacatgttcagtgacttgaaggatctggttctg
ccagacatcgaacgttacttcacttcctcagactgccgacagttcaaccgctctgagtct
ctcaggctcgcagatgagctaagaggatgggttcatcgacatcaaatcgacaggaagaag
tctggaggaaaagcaaagacggccaaaaaagcaaagatcacccagaaagctcaactgagg
aaggcaaacatttccagatatctgccaatccaggctcaccgctccatagaaagtcagctg
agggtacttcctggtcctgaggtcacctacagcgacttcctggacgccatcgaccgtagg
gaagacacgttctacgtcgtgtctttcaggagggaccacctgttactgcctgccatcagc
cataacaaaaccagccggcctaaaatgtctctggtgatgccagccatgtctgttaacgag
agtctctacaactcgtctcagggctacgagatgatgatgcaggtcgactgcgaggtcatg
gacactcgcatcatccccataaagtcctctgccgtccctccatctcttcgtgaaccctcc
cctcctccaccctcctcccagcatggtgcccaccatcaccatggcaacagcacctccctc
agaggacgccaccagcaccatccatcgtcttcatccccttctccaaggcagcctctacct
gcccgaactcaaacacccgaatacttgatcagccaatcagaaggagtctga

DBGET integrated database retrieval system