KEGG   Xanthomonas campestris pv. vesicatoria: XCV2591Help
Entry
XCV2591           CDS       T00288                                 

Gene name
gst6
Definition
(GenBank) glutathione transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XCV2591 (gst6)
Enzymes [BR:xcv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     XCV2591 (gst6)
Transporters [BR:xcv02000]
 Other Transporters
  Pores ion channels [TC:1]
   XCV2591 (gst6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: CAJ24268
UniProt: Q3BSE1
LinkDB All DBs
Position
complement(2920584..2921282)
Genome map
AA seq 232 aa AA seqDB search
MITVHHLNNSRSQRVLWLLEELALPYQIVRHERDPKTMLAPPALRAIHPLGKSPVLVDGD
LVVAESGAILEYLTERYDTECALSPSPRPLDSPERLQFRYWMHYAEGSAMPPLLMTLIFG
RIRSAPMPFFAKPIARAIVDKAMSGFVGPQLTLHLDWMEQSLQAGNWFAGERFTAADIQM
SFPVQAAAARGGGLEKYPRLHAFLQRIQARPAYQAALKKGGPFELMGSKPAN
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgtccaccatctcaataattcccgttcccagcgcgtgctgtggctgctggaa
gaactggcgctgccttaccagatcgtgcgccatgaacgcgaccccaagaccatgctggcg
ccgccggcgctgcgcgcgatccatccgctgggcaaatcgccggtgctggtcgatggcgat
ctggtcgtagccgaatctggggcgatcctggagtacctaaccgagcgctacgacaccgag
tgcgcgctgtcgccatcgccgcggccgctggattcgcccgagcgcctgcagtttcgctat
tggatgcattacgccgaaggctcggcgatgccgccgttgctgatgacgctgatcttcggt
cgcatccgcagcgcgccgatgccgttcttcgccaaacccatcgcacgtgcgatcgtggac
aaggcgatgtcgggcttcgtcgggccgcagctcaccttgcatttggactggatggagcag
tcgttgcaggccggcaactggttcgctggcgaacgcttcaccgccgccgacatccagatg
agcttccccgtacaggcggcggccgcacgcggcggcggtctggagaaatacccgcgtttg
cacgcgtttctgcagcggatccaagcgcgtccggcgtatcaggctgcgttgaagaaaggc
ggcccgttcgagctgatgggaagcaagccggccaattga

DBGET integrated database retrieval system