KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr24050Help
Entry
XFF4834R_chr24050 CDS       T03094                                 

Gene name
gst6
Definition
(GenBank) probable glutathione transferase Gst6/GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xfu  Xanthomonas citri pv. fuscans
Pathway
xfu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xfu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XFF4834R_chr24050 (gst6)
Enzymes [BR:xfu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     XFF4834R_chr24050 (gst6)
Transporters [BR:xfu02000]
 Other Transporters
  Pores ion channels [TC:1]
   XFF4834R_chr24050 (gst6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: CDF61923
UniProt: A0A2H1S5M0
LinkDB All DBs
Position
complement(2772973..2773671)
Genome map
AA seq 232 aa AA seqDB search
MITVHHLNNSRSQRVLWLLEELALPYQIVRHERDPKTMLAPPALRAIHPLGKSPVLVDGD
LVVAESGAILEYLTERYDTECALSPSPRPLDSPERLQFCYWMHYAEGSAMPPLLMTLIFG
RIRSAPMPFFAKPIARAIVDKAMSGFVGPQLTLHLNWMEQSLQAGNWFAGERFTAADIQM
SFPVQAAAARGGGLEKYPRLHAFLERIQARPAYQAALKKGGPFELMGSKPAK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgtccaccatctcaataattcccgttcccagcgcgtgctgtggctgctggaa
gaactggcgctgccctaccagatcgtgcgccatgagcgcgaccccaagaccatgctggcg
ccgccggcgctgcgcgcgatccatccgctgggcaaatcgccggtgctggtcgatggcgac
ctggtcgtggccgaatctggggcgatcctggagtacctgaccgagcgctacgacaccgag
tgcgcgttgtcgccatcgccgcggccgctggattcgcccgagcgcctgcagttttgctat
tggatgcattacgccgaaggctcggcgatgccgccgttgctgatgacgctgatcttcggt
cgcatccgcagcgcgccgatgccgttcttcgccaagcctatcgcgcgtgcgatcgtggac
aaggcgatgtcgggcttcgtcgggccgcagctcaccttgcatctgaactggatggagcag
tcgttgcaggccggcaactggttcgctggcgaacgcttcaccgccgccgacatccagatg
agcttcccggtacaggccgctgctgcacgcggcggcggtctggagaaatacccgcgtctg
cacgcgtttctggaacggatccaagcgcgtccggcgtatcaggctgcgctgaagaaaggc
ggaccgttcgagctgatgggaagcaagccggccaagtga

DBGET integrated database retrieval system