KEGG   Xanthomonas gardneri: BI317_05905Help
Entry
BI317_05905       CDS       T04668                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
xga  Xanthomonas gardneri
Pathway
xga00260  Glycine, serine and threonine metabolism
xga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BI317_05905
Enzymes [BR:xga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     BI317_05905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 Pyr_redox_3 2-Hacid_dh_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: APP86853
UniProt: A0A0G8JSJ3
LinkDB All DBs
Position
complement(1292973..1293995)
Genome map
AA seq 340 aa AA seqDB search
MKALVKREANKGIWLEQVPVPSPGPNEVLIKLEKTAICGTDLHIYVWDEWSQRTITPGLT
IGHEFVGRVAELGSAVTGYQVGQRVSAEGHIVCGHCRNCRGGRPHLCPNTVGIGVNVNGA
FAEYMVMPASNLWPIPDQIPSELAAFFDPYGNAAHCALEFDVIGEDVLITGAGPIGIIAA
GICKHIGARNVVVTDVNDFRLKLAADMGATRVVNVSKTSLKDVMADLHMEGFDVGLEMSG
NPRAFNDMLDCMYHGGKIAMLGIMPRGAGCDWDKIIFKGLTVQGIYGRKMYETWYKMTQL
VLSGFPLHKVLTHQLPIDDFQKGFDLMEEGKAGKVVLSWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctggtcaagcgcgaagcgaacaagggcatctggctggaacaggttcccgtc
cccagccctggccccaacgaggtgctgatcaagctggaaaagaccgcaatctgcggcacc
gatctgcacatctacgtgtgggacgagtggagccagcgcaccatcacacccggcctgacc
atcggccatgaattcgtcggccgtgtggccgagctcggttcggcggtcaccggttaccag
gtcggccagcgcgtctcggccgaaggccacatcgtgtgcgggcattgccgcaattgtcgc
ggcggccgcccgcatctgtgccccaacacggtcggcatcggcgtcaacgtcaacggcgca
tttgccgaatacatggtgatgccggccagcaacctgtggccgatccccgaccagattccc
tccgagctggccgcattcttcgacccctacggcaacgccgcgcattgtgcgttggaattc
gacgtgatcggcgaagacgtgctgatcaccggcgccggcccgatcggcatcatcgccgcc
ggtatctgcaagcacatcggtgcgcgcaacgtggtggtcaccgacgtcaacgatttccgt
ctcaagctggccgccgacatgggcgccacccgcgtggtcaacgtctccaagacatcgctc
aaggacgtcatggccgacctgcacatggagggcttcgacgtggggctggaaatgagcggc
aacccgcgcgcgttcaacgacatgctcgactgcatgtatcacggcggcaagatcgccatg
ctcggcatcatgccgcgcggcgccggctgcgactgggacaagatcatcttcaagggcctc
accgtacagggcatctacggccgcaagatgtacgagacctggtacaagatgacgcaactg
gtgctgtcgggctttccactgcacaaagtgctgacccatcaattgccgatcgacgatttc
cagaagggcttcgacctgatggaagaaggcaaggccggcaaggtcgtgttgagctggaac
tga

DBGET integrated database retrieval system