KEGG   Xenopus laevis (African clawed frog): 100462927Help
Entry
100462927         CDS       T01010                                 

Gene name
cacna1e.L, ca(v)2.3, cacna1e, cav2.3
Definition
(RefSeq) calcium channel, voltage-dependent, R type, alpha 1E subunit L homeolog
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100462927 (cacna1e.L)
   04020 Calcium signaling pathway
    100462927 (cacna1e.L)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xla04040]
    100462927 (cacna1e.L)
Ion channels [BR:xla04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100462927 (cacna1e.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 100462927
NCBI-ProteinID: XP_018113997
Xenbase: XB-GENE-6492359
LinkDB All DBs
Position
4L
AA seq 2164 aa AA seqDB search
MFLLYQFQCIFLNYCLTPFEYMILATIIANCIVLALEQHLPGDDKTPMSRRLEKTEPYFI
GIFCFEAGIKIVALGLVFHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAV
RVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHKACY
RNNSGMELEPMDPPHPCGVPRCPTGYECKEWIGPNDGITQFDNILFAVLTVFQCITMEGW
TTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLR
RNQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRSRTEAINRDSSEDH
CVDISSVGTPLARASIKSAKMDGASYFRHKERLLRVSVRHMIKSQVFYWMVLGVVALNTF
CVAIVHHNQTLWLSNVLYYAEFLFLGLFLVEIAFKMYGMGPRLYFHSSFNCFDCGVTLGS
IFEVLWAIFRPGTSFGISVLRALRLLRIFKITKYWSSLRNLVVSLMNSMKSIISLLFLLF
LFIVVFALLGMQLYGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQG
GVRSGMWSSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQK
AKEVSPMSAPNASSIEKDRRKRNTLSIWEQRTSQLRRHIQMSSQEAIQSEELTALNPHSS
IYRKSKEADEQKTEKEEGDQDVKLVITPVEGPPEGEGSPSNRNLREHWRQKSRHGNAENT
EPNGTTPEEALRRRQSQRRSRHKRVRTEGREQCSNPNSTSASREGGLDKVTVEDGRTIPE
EKSNEEAKEVRGVDDEPLKICISSRNPQDRNNKTLGCEGIALNDTPLKDVNNHEKDSSPP
DLDCSEQALLGSIRSQESPNPTSCSLPDVSSSTERVTESTVITLPDTGVPADCTVVQMSE
GRDGEVNFRSSQQEKIEEDTEDGEERTIKRKEKLLESPKAIVPYSSMLIFSSTNPIRKVC
HYIVNLRYFEMSILLVIAASSIALAAEDPVLTNSDRNKVLRYFDYVFTGVFTFEMIIKMI
DQGLILHEGSYFRDLWNILDFVVVVGALIAFALANVLGTNKGRDIKTIKSLRVLRVLRPL
KTIKRLPKLKAVFDCVVNSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKETE
KECIGSYIDHEKNKMEVKRREWKRHDFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDITE
EDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERAC
IDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPYTY
ELALKYLNIAFTMLFSLECILKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDTKLVN
TSSFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGM
QVFGNIRLEEDSHINRHNNFRSFFSSLMLLFRSATGEAWQEIMLSCLSDKRCEPDTSATS
GHNENERCGTELAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVR
IWAEYDRAACGRIPYKDMYKLVRVISPPLGLGENCPYRVACKRLVLMNMPVSEDMTVHFT
STLMALIRTALDIKIAKGGADRHLLDSELQKETLAIWPNLSQKMLDLLVPMPKASDLTVG
KIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEASALPEEILSNAKALPYLEQDTV
SGLGGFPSLSPLSPEEVFQPPCLDRDDEDFEEQLSLEPEVREFSREQLPNRGSYIPVEML
ERPASVRASSMPRLAENPQVLSDVSSMRRSFSTTAEKRARSSWLDEFTMDRSSTDCAYRY
QRRSYHASIRLSANRLNTDTGHWSDNHRSGGRERGRSKERKHLLSPDPSRCNSEERIPQA
ACEHRDHQLSPGHTPCSVQILDSLSESCTPSDTSTPRQGRRQLPSVPPTPRPLISFSSLI
RQQKQSPHPQNNNDIILPSEPGLSESSCSLGGHQSSQSTPQHYISEPYLALHEEMQSSDC
PTEDTLTFEVAVATSLGRSNTIAAAPLRHGWQMPNGHYRRRRKGGIPPVIPSRELSDTEE
DDRC
NT seq 6495 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgttatatcaatttcagtgtattttccttaattattgtctcactccttttgag
tacatgatccttgccacaattattgcaaactgcattgtcctggctttggagcagcatctt
ccaggggatgacaagactccaatgtctcgcagattggaaaagactgagccctacttcatt
ggaatattttgctttgaagctgggattaaaattgtcgctctggggctggtttttcacaaa
ggttcttatctccggaatggctggaatgtcatggactttatagtagtgctcagtggcatc
ctggccacagctggaactcacttcaacactcatgtggacctgcgtactttacgggcagtg
cgtgttctcaggccactgaaactggtctcggggattcctagtttacagattgtgttgaag
tcaatcatgaaggcgatggttcctctgctacagattggattgttgcttttctttgccatc
cttatgtttgctatcatcggccttgagttttacagtggaaagctgcacaaggcctgttac
aggaacaactctggaatggagctggagcccatggacccacctcatccttgtggagtgccc
cgttgcccaactgggtacgagtgcaaggaatggattggacccaatgatggaataacacag
tttgacaacatcctatttgcagtgctgacagtcttccagtgtataactatggagggctgg
accacagtgctgtacaataccaatgatgccttaggagccacgtggaactggctgtacttc
attcccctcattatcatcggatccttctttgtccttaatcttgtcctcggagtgctgtct
ggtgaatttgccaaagagagggagagagtggaaaaccgtcgggctttcatgaagttgcgt
aggaatcagcagattgaaagggagctgaatggttatcgagcatggatagataaagctgag
gaagttatgttggccgaagaaaataaaaattcagggacctctgctttagaagttcttaga
cgagcgaccattaaaagaagtagaacagaagccatcaaccgggactctagcgaggaccac
tgtgttgacatatcgtctgttggcaccccccttgctagagcaagcatcaagagtgccaaa
atggatggggcatcatattttcgtcacaaagaacgactattgcgtgtctctgttcgtcac
atgatcaaatcccaggttttctactggatggtcctgggagtggtagcacttaacactttc
tgtgtggctattgtccaccacaaccagaccctgtggctctcaaatgtcctttactatgca
gaatttctgtttcttggattatttttggtggagatagcttttaaaatgtatggaatgggc
ccacgtctttactttcactcctccttcaactgctttgattgtggggtcacattaggtagt
atatttgaagtactttgggccatctttagaccagggacttcctttggaatcagtgtccta
agagctctccgacttttgagaatctttaaaataacaaaatactggtcctcactaaggaac
ctggtagtctccctgatgaattctatgaagtccatcatcagcctgctcttccttctattc
ctcttcatagttgtttttgccctcctaggaatgcagctatatggtggcagattcaatttt
aatgatggcactccatctgcaaactttgatactttccccgcagccatcatgactgtattc
cagattttgacaggagaggattggaatgaagtgatgtacaatggtattcgctcccagggt
ggtgttcgatccggaatgtggtcttccatatactttattgtccttaccctctttggaaat
tacactctgctaaatgtatttcttgccattgctgtggacaaccttgctaatgcacaagag
ttaactaaggatgagcaagaagaagaggaagctttcaatcagaagcatgcactgcaaaaa
gccaaggaggtcagccccatgtctgcgcctaacgcatcgagtattgagaaggatcgcaga
aaacggaacacattgtctatatgggaacagcgcacaagtcagctaaggaggcacatacag
atgtctagtcaagaagctattcagagtgaagaactgacagctctaaatccacactccagt
atctatcgcaagtcaaaggaagctgatgaacaaaaaacagaaaaagaagaaggggatcaa
gatgtaaaactggttataaccccagtggaaggaccaccagaaggagaaggaagcccttct
aatagaaatctcagggaacactggcggcagaaatccaggcatggaaatgctgaaaacact
gagccaaatggaacaactccagaggaagcactgcgccgtagacaaagtcagagacgcagc
cgtcataaaagagttagaactgaaggtcgtgagcagtgtagcaatccaaacagcacctca
gcaagcagagaaggtggtcttgataaagtgaccgtagaggatggaagaacaattccagaa
gagaagagcaatgaagaagccaaagaagtcagaggggtggatgatgagcctcttaagatt
tgcatatcctcaagaaatcctcaagacagaaataacaagactttgggttgtgagggtatt
gccttgaatgatactcccctgaaggatgtgaacaaccatgagaaggacagtagccctcct
gatttggattgcagtgagcaggctctgctgggcagcattcggagccaggaaagccctaat
ccaaccagctgcagtttgccagatgtgtccagcagcaccgagcgcgtcactgagagcaca
gtcattaccttaccagatactggagtgcctgccgactgcaccgtggtacagatgagtgaa
ggaagggatggagaagtcaactttagatcttcacagcaagaaaaaatagaggaggacact
gaggatggagaagaaagaactataaaacgaaaagagaaattgttggagtcccccaaagcc
attgtaccgtacagttcaatgctcatcttcagctccaccaatcccataagaaaagtatgc
cattacattgttaatctacgatactttgagatgagcatcctgctggtaatagcagcgagt
agcattgccttagcagcggaggatcctgttctgaccaactcagaccgcaacaaagttctt
cgctattttgactatgtttttacaggagtcttcacttttgagatgattataaagatgatc
gaccaaggtttgattttacacgagggctcctactttcgtgacctctggaacatcttggat
tttgtggtggttgtgggagccttaattgcctttgccttagccaatgttttggggactaac
aaaggacgggacatcaaaactattaagtctctacgtgtgttacgggtgctgcgtccacta
aagaccatcaaacgcctgccaaaactgaaggcagtctttgattgtgtggttaactcttta
aagaacgtctttaatattctgatcgtatacaaactcttcatgttcatatttgctgtcatt
gctgtgcagctgtttaagggcaagttcttctactgtacagacagctcaaaggaaacagag
aaagagtgcatagggagctacatagatcatgaaaagaacaagatggaggtgaagcgaagg
gaatggaaaagacacgatttccattatgacaacattatatgggctcttcttaccctcttt
actgtatcaacaggagagggttggcctcaggttctgcagcactccgttgatataacagaa
gaagataggggtccaagtcgaagcaaccgcatggagatgtccattttctatgttgtctac
tttgtggtcttccccttcttctttgtaaatatatttgtggctctgattatcatcacattc
caggagcaaggagacaagatgatggaggagtgttccctagagaagaatgagagagcctgc
atagactttgcaatcagtgccaagccgcttacaagatacatgccacagaacagacacaca
ttccagtaccgggtctggcactttgtggtctccccttcatttgaatataccattatggct
atgattgcactaaacacagtggtacttatgatgaagtattattccgcgccatacacatat
gagcttgcattaaagtatctgaacattgcattcacaatgctcttttctctggagtgcatc
ctcaaaatcattgcatttgggtttttgaattactttcgggatacgtggaacatttttgac
ttcattactgtaattggtagcatcacggaaatcattttaacagacactaagttggtaaac
acgagcagctttaatatgagctttctgaagctgttccgagccgcacgacttattaaactt
ctccggcaagggtacaccatccggatcctgttgtggacttttgttcagtcctttaaggca
cttccttatgtgtgtctcctcattgcaatgttgttcttcatctatgctatcatcgggatg
caggtgtttggcaatatccgcctggaagaggacagccatattaataggcacaacaatttc
agaagtttctttagttctcttatgttactcttcaggagtgccacaggagaggcttggcag
gagatcatgctttcatgccttagtgataagcgttgtgaaccagacaccagtgcaacttct
ggacacaatgagaatgagcgctgtggaactgaacttgcatatgtttattttgtttcattc
attttcttctgctccttccttatgctaaatctgtttgtggctgtcattatggacaacttt
gaatacttgacacgggactcctccattttgggacctcatcacttggatgagtttgttcgg
atatgggctgaatatgatcgagcagcatgtggcaggatcccctataaggatatgtacaaa
ttagtccgagtcatctcgcctccgctcggcctaggagagaactgcccatacagggtggca
tgcaagagactggtcctgatgaatatgccagtgtcggaggacatgacggtacatttcaca
tcaactcttatggccctaatacgcacagcattggatatcaaaatagccaaaggaggcgct
gacaggcacctgctggactctgagctgcagaaagaaacacttgccatttggccaaatctc
tcccagaaaatgctggacttacttgtgccaatgccaaaagcctctgatctgacagttggg
aagatttacgctgcaatgatgatcatggattattataaacagagcaaagccaaaaaacag
aggcagcagctggaggagcagaaaaatgcaccaatgttccagagaatggaggcttccgcc
ctccctgaggaaatcttatccaatgctaaagcattaccataccttgagcaagacactgta
tcaggcttgggtggattcccttcactgagtcccctgtccccagaagaggtattccagccg
ccatgcctagacagggatgatgaagactttgaagagcagctgtctctggagcctgaggtt
agagagtttagcagggagcagctccctaaccgaggcagctacatcccagtggagatgctg
gaacgtccagcgtctgtgagagcttcctccatgccacgtctggctgagaaccctcaggtc
ctgtcagacgtaagctcaatgcgtcgctccttctccacaactgcagagaagcgagcacgc
agctcgtggctagatgagttcactatggacaggagcagcacagactgtgcatacagatac
cagaggcgcagttatcatgcatctataagactgtctgcaaatcgcctgaatacagataca
ggccattggtcagataatcaccgttctggtggaagagagcgaggaaggtccaaagaaaga
aaacacctgctgtcccctgatccttctcgctgtaattctgaggaaaggatcccacaagct
gcctgtgaacaccgagatcaccaactgtcccctgggcacactccctgcagtgtacagatt
cttgactctctgagtgaaagttgcaccccttcagacaccagcaccccaagacaaggccgc
aggcagcttccctcggtgcctccaactcctagacctcttatttccttctcttcgcttatc
cgccaacagaaacagagcccccatccccaaaataataatgatattatccttccaagtgag
cctggtctgagtgagtcttcctgctcccttggcggtcaccagagctcccagtccacacca
cagcattatatctcagagccctacctggcactgcatgaggagatgcaaagctcagactgc
cccacagaggacacactcacctttgaagttgctgtggctactagtctgggccgctctaac
accattgccgctgccccactgcgtcatggctggcaaatgccaaatggtcactaccggcgt
cgaaggaagggaggcattccaccagtgataccctccagagaattaagtgacacagaagag
gatgatcgatgttaa

DBGET integrated database retrieval system