KEGG   Xenopus laevis (African clawed frog): 100505445
Entry
100505445         CDS       T01010                                 

Gene name
epo.S, epo, epoetin
Definition
(RefSeq) erythropoietin S homeolog
  KO
K05437  erythropoietin
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100505445 (epo.S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xla04052]
    100505445 (epo.S)
Cytokines and growth factors [BR:xla04052]
 Cytokines
  CSF and other factors
   100505445 (epo.S)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100505445
NCBI-ProteinID: NP_001184210
Xenbase: XB-GENE-8596270
UniProt: D4AFJ9
LinkDB
Position
5L
AA seq 180 aa
MGVTGLLTLLSMLLVSVKLVTCAPYKPVCDKTVLDMFIKEARELETAMDSCNIICQFPED
IMVPETKLNVGEWNKLQTSQQAAEVWNGLVLFTKAVPRITDFISDASLKFQVEKIHSDIR
SVVHLFKSLNLQDEAQTSQTEGKTLPVRTFKKLFSVYTNFLRGKLRLLVMAVCREASLPT
NT seq 543 nt   +upstreamnt  +downstreamnt
atgggtgtgactggtttacttactctgctatcaatgttgctcgttagtgtgaagctcgtt
acatgcgccccctacaagcctgtctgtgacaaaacagtactggacatgttcattaaagaa
gccagagaattggaaacagccatggactcctgcaacattatctgccaatttcctgaggat
atcatggtccctgaaacaaaactgaatgtcggagagtggaataaattacagacgtcccag
caggcggcagaggtttggaacggtctcgtcttatttacaaaagctgtcccaagaattact
gatttcatctccgatgccagcctcaaattccaagttgaaaaaatccacagcgacatccgc
agtgttgtgcatttatttaagagcctcaacttgcaggatgaagctcagacatcacagaca
gaaggaaagacacttccagtacggacattcaaaaaattattttctgtttacaccaatttt
ttacgaggtaaattgagactactagtgatggcagtgtgccgggaggctagtctaccaacg
tga

DBGET integrated database retrieval system