KEGG   Xenopus laevis (African clawed frog): 108708038
Entry
108708038         CDS       T01010                                 

Gene name
nos2.L, nos2a
Definition
(RefSeq) nitric oxide synthase 2 L homeolog
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00220  Arginine biosynthesis
xla00330  Arginine and proline metabolism
xla01100  Metabolic pathways
xla04020  Calcium signaling pathway
xla04146  Peroxisome
xla04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    108708038 (nos2.L)
   00330 Arginine and proline metabolism
    108708038 (nos2.L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108708038 (nos2.L)
   04020 Calcium signaling pathway
    108708038 (nos2.L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108708038 (nos2.L)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     108708038 (nos2.L)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 108708038
NCBI-ProteinID: XP_018101803
Xenbase: XB-GENE-17343713
LinkDB
Position
2L
AA seq 1158 aa
MMCPWKRFMKIGTVKEKLSCHEIDMNNNQDFGKTHSKIIKEAIDFNGKKQTMAELKSVSE
KRFPENIKQSQKRETCPKYLKLKNFENGTIFQDTLHLKAKKNLGCQSKICQGSIMNPKVY
IRGPRTEPVPQDEILLQAIEFVNQYYSSFKEPQIENHLNRLETVAKEIECTGTYQLTKDE
LIYATKMAWRNAPRCIGRIQWSNLQVFDARDCKTTKEMFDHLCRHLNYSSNGGNIRSAIT
IFPQRTDGKHDFRVWNSQLVRYAGFQMPDGSILGDPASIEFTELCIHLGWKPQYSRFEIL
PLVLQANGQDPDLFEIPSDIIDEVPIEHPKYEWFKELGLRWYTLPAVANMLLEVGGIEFS
ACPFNGWYMGTEIGVRDFCDVQRYNVLEEVGRRLGLETHKLTSLWKDQAAIELNIAVLYS
FQKHNVTIMDHHSAAESFMKHLENEYRLRGGCPADWVWLVPPMSGSITPVFHQEMLNYIL
SPFYYYQIDAWKTHVWQDENRKPKKKEFKFSVVAKSVLFASSLLKKTVAARTKVTILYAT
ETGKSETFAKKLQELFSYAFNAKVLCMDDYNIRNLENETLLLVVTSTFGNGDCPGNGEKF
KKAMFSYKELKNKLRYAVFGLGSSMYPQFCAFAHTVDQRLAQLGATQISITGEGDELSGQ
EEAFLNWAVQTFKAACELFKIRDRHNIHLPKCYTSTETWSAANYRLVNENQPYDHIKALN
KLHSRSILPMKLKSRQNLQSLKSSRATLLVKLSYENSQEVRYMPGEHVGLFAGNHPELVM
SIIRHLKDAPPGNQHIRLETRTEQDNFWTISEKIPPCSLTQALTYFLDITTPPTQLLLKK
LSLLATEVTDKNRLEELSKNSDEYNQWKNHNFPNFLEVLEEFPSLHVPTTFVLTQLPPLK
PRYYSISSSNDMVPGEVHLTVAVVNYTTRGGQGPLHHGVCSTWLNTLNINETVPCFIRST
NTFHLPENPSVPCVLIGPGTGISPFRGFWQQRLYDLEKKGIKAGSMILLFGCQQSGMDEI
YADETKYMKNKGILKDVYTAYSRQPGQAKMYVQDILLKNLESEVCRILFEEEGHLYVCGN
FDMAKDVVQTLKHLIAKRLRLNEEETENYFSELKNKLRYHEDIFGPAHRPQHSKNGYHSL
VALSTPVYTVHHRTKIMK
NT seq 3477 nt   +upstreamnt  +downstreamnt
atgatgtgcccctggaaacggttcatgaagatcggaactgttaaagaaaaattgtcttgc
catgaaatcgacatgaacaataatcaggacttcggaaaaacacacagcaaaatcataaaa
gaagcaatcgatttcaatggcaagaagcaaacaatggctgaactcaaatctgtatcggag
aaaagatttccagaaaacataaagcagtcgcagaaaagagaaacctgtcctaaatatttg
aagctgaagaattttgaaaatggaacaatcttccaagacactttacacctcaaagcaaag
aagaacctaggctgccagtctaaaatatgtcagggatccatcatgaacccaaaggtgtat
ataagaggccccaggactgagccagtgccacaagatgaaattttacttcaagcaattgaa
tttgttaaccagtactacagctccttcaaagagcctcagatagaaaatcacctcaacagg
ctggaaactgtggccaaagaaatagaatgtaccggcacctaccagctaactaaagatgag
cttatctatgcaaccaagatggcttggagaaatgctccccggtgcattggacgaatacag
tggtccaacttacaggtttttgatgctcgtgactgcaagacaaccaaagaaatgtttgat
cacctatgccgtcacttaaattactcgtcaaatggaggaaacataagatctgctattacc
atatttcctcagaggactgatgggaaacatgatttcagagtgtggaacagtcagcttgtt
cgttatgccggctttcaaatgccagatggatcaatccttggagacccagccagtatagaa
tttacagagttgtgtatccatcttggatggaagccacaatacagtcggtttgagatcctc
cctttggtgcttcaggcaaatggccaagatccagatttgtttgagatcccctcagatatc
atcgatgaagtaccaatagaacacccaaagtatgagtggttcaaggaacttggcctgagg
tggtatacgttacctgcagttgccaatatgcttcttgaagttggaggtatagagttctct
gcttgcccattcaacggctggtacatggggacagaaattggcgtgcgggatttctgtgat
gttcagcggtataatgtgcttgaggaagtaggaaggcgactgggtttagagacacacaaa
ctgacttcattgtggaaagaccaagctgcgattgagctcaatattgctgttctatatagt
tttcagaaacacaacgtgaccattatggatcaccactctgcagcggaatcctttatgaag
cacctggagaatgagtaccggttacgaggaggctgcccagctgactgggtttggcttgtc
cccccaatgtcaggcagcattacaccagtgtttcaccaagaaatgctgaattacattcta
agccccttttattactatcagattgatgcttggaaaactcacgtgtggcaggacgaaaac
cgtaagccaaagaagaaggaattcaagtttagtgtagtggcaaagtctgtgctatttgct
tcctcactcttaaagaaaactgtggctgccagaaccaaagtaacgatcctctatgcgaca
gaaactgggaaatctgaaacatttgcaaagaaactgcaagaattgttcagttatgccttc
aatgccaaggttctctgtatggatgactataacatcagaaacttggagaatgaaactctt
ttactggtggtgacgagcactttcggaaacggagactgcccaggaaacggagagaaattt
aagaaagcaatgttttcttacaaagagctaaagaacaaattaaggtatgctgtttttggc
cttggatccagcatgtacccgcagttctgtgcatttgctcatacagtagaccaaagactg
gcacagcttggggccacgcaaatcagcattactggtgaaggagatgaactcagtgggcag
gaagaggctttcctaaattgggcagttcaaacatttaaggctgcatgtgaactatttaaa
attcgagacagacacaatattcatttacctaagtgttacacctcaacggaaacctggagt
gcagcaaattatcgccttgttaatgagaaccaaccatatgaccacatcaaagcactcaat
aaattgcactccaggagcatactgccaatgaaactgaaatctaggcagaacttgcaaagc
ctcaaatccagccgtgccacactgcttgtgaagctttcctatgagaacagtcaggaagta
cgatatatgccaggagaacatgttggtttgtttgctggaaaccatccagagctagtaatg
agcataattagacatctgaaggatgctccgcccggcaatcaacatatccgactggagaca
cggactgagcaggataacttctggacaatcagtgaaaaaatccctccttgctctttgaca
caagcactgacatatttcctagacataactacgccaccgacgcagcttctgctgaaaaaa
ctctccctgctggcgaccgaggtcacggataaaaacaggctggaagagttaagcaaaaat
tcagatgaatacaatcagtggaagaaccataactttcctaacttcctggaggtactagaa
gagtttccatccctacatgtgcctacaacatttgtgctcactcagctgccacctctgaaa
cccagatactactctatcagttcctcaaatgatatggtgcctggggaggtccatctcact
gttgctgttgtgaactacacaacaagaggtggccagggcccattacatcatggcgtctgc
agcacatggctaaacactctgaatatcaatgaaacagttccatgctttattagaagcacc
aacacattccatctcccagaaaacccatcagttccatgtgtattgattggccctggaaca
ggaatttctccatttagaggattttggcagcagcgactctatgacctagaaaagaaagga
ataaaggccgggtctatgatactactgtttggctgccagcaatcagggatggatgaaatt
tatgcagacgagacaaaatatatgaagaataaaggcatattgaaagatgtgtacactgca
tattccaggcagccaggacaagccaagatgtatgttcaagatattcttctaaagaacttg
gagagtgaagtgtgtcggattttgtttgaagaagaaggccatctgtacgtgtgtggaaac
tttgacatggcaaaggatgttgttcagaccctgaaacacttgatagccaagaggttgaga
ctaaacgaggaagaaactgaaaattatttctctgagctgaagaacaaattaagatatcat
gaagatatatttggccctgctcataggcctcagcattcaaaaaatggataccattctctt
gtggctcttagtacaccagtctatactgtacatcataggactaaaattatgaaatag

DBGET integrated database retrieval system