KEGG   Xenopus laevis (African clawed frog): 779432Help
Entry
779432            CDS       T01010                                 

Gene name
kmt5c.L, kmt5c, suv420h2
Definition
(RefSeq) lysine (K)-specific methyltransferase 5C L homeolog
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    779432 (kmt5c.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    779432 (kmt5c.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     779432 (kmt5c.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     779432 (kmt5c.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 779432
NCBI-ProteinID: NP_001090519
Xenbase: XB-GENE-6252183
UniProt: A0JMZ4
LinkDB All DBs
Position
7L
AA seq 761 aa AA seqDB search
MGSNRLTARELCENDDLATSLVLDPYLGFRTHKMNVSAMPTIRRQHHLREALQTFCKKKD
LEAAYQSLTAGGWARHYFHSRTRQQESLLKTHIFRYLRMFLPESGFMILSCSRYSLEMNG
AKVVSTKSWSKNEKIELLVGCIAELSKADETLLRFGDNDFSVMYSTRKKCAQLWLGPAAF
INHDCRPNCKFVPTEGNTACVKVLREIKTGEEITCFYGDSFFGEKNEMCECCTCERKGDG
AFKQQNTEQTVSTSLEKYQLRETDGRLKRLSESACKPSPQVTTKKKGSKLRLSLRLKRIP
ASRRKGAFYRRVKTFASSRYFYKSHLMKHIPLKPVKIALPRGTVLRDVRIILHNCKKCNQ
ASRPKSQHERQCCKLGKEPLVSLRREDLSPERLKFRLSCPGGSCPPIIQTANVGCNAKDC
SQTEAGKSNLEQITTAELCEHLSFSPVPSHNEDDNSFYEPEIPGSLLGPESPSSEPLSNN
LNLECNSPEPIVINTVYPHYNGGVTSDSHPHALKQFGITHYIQVDLRKDVTLEPGRSQPD
KSSLEAEKKQIPNNKHSQHPVISDDHLVANLNAETQSNAVSPPTNTPICEALNGSLEHKV
FSLRSRPVSFRPRKTSDNKITLFKRRRSSVKQGVRCVKLNGHVKLTGQLVPSKLHPPPGA
GANHLTDAMHSDPKLLLKPYVELGLNNNLKRQSLTGLPPSTVLTGDAFNILHSPPASKQS
TEGATKNVAFNPFTPSKRLRLVVSHGSIALDMASTSSEETS
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgggttcaaatcggttgacggcaagagaactttgtgagaatgatgacctcgcgacgagt
ttggtgcttgacccttacctggggtttaggactcataaaatgaacgtcagtgccatgccc
acgataagaaggcagcatcacctgagagaggctttgcaaacattctgtaagaaaaaggac
ctggaagctgcgtaccagtcactaacagcaggcggatgggctcgtcattatttccacagt
cgcaccaggcaacaggagagtctgctcaagacacatatattccgatatctccggatgttt
cttccagagagtggttttatgatcctttcctgtagtcggtactctctagaaatgaatgga
gcgaaagttgtctccactaagtcatggtccaagaatgaaaagattgaactcctggtgggg
tgcattgctgaactaagcaaagcagacgagaccctccttcgattcggagacaatgatttt
agcgtcatgtactccactcggaaaaagtgtgcacagctctggttaggacctgctgccttt
atcaaccacgactgtcggccaaactgcaagtttgtaccaacagagggaaacacggcgtgt
gtaaaggttctcagggaaatcaaaaccggtgaagagatcacatgcttctacggtgacagc
ttttttggagagaaaaatgaaatgtgtgaatgttgcacatgcgaaagaaaaggggacggt
gcttttaagcagcaaaacacagagcagacagtatctacctcattagaaaaataccagctc
cgtgagacagacggtcgtctgaagagactgagcgagagtgcctgcaaaccatccccgcaa
gtaactacaaagaaaaagggttcaaaacttagactatcgctcagactgaaacggattccg
gcatcccgcagaaagggagctttctatcggagagtaaagacttttgcttcctctcgctat
ttttataaatctcacctaatgaagcacattcccttgaaacctgtgaagattgcacttccc
cgcggtactgttttaagggacgtgcgtatcattctgcataactgcaaaaaatgtaaccag
gcctcccgtcctaaaagccagcatgagaggcaatgctgcaagctaggaaaggaacctttg
gtatcgcttcgccgggaagacctcagccctgaaaggcttaaatttcgattaagctgccct
ggtggttcatgccctcctataatccagacggctaacgtagggtgcaatgccaaagattgt
tctcaaactgaagcaggaaagtccaacctggaacagatcacaacagccgaattgtgtgaa
cacttgtctttctcccccgtgccgagtcacaacgaagatgacaactctttctatgagccc
gaaatccccggttcattgttgggtcccgaaagtccatcttctgaaccactttccaacaac
ttaaacctggaatgtaattctcctgaacctattgttataaacactgtgtatcctcattat
aatggcggcgtaacatctgattcgcatcctcatgcgcttaaacagtttgggataacccat
tatattcaagttgatctaagaaaagatgtaaccttagaacctggaaggtctcagcctgat
aagagttcattggaagcagaaaagaagcagattccgaataataaacattctcagcaccct
gttatttcagacgaccaccttgtggctaatttgaatgccgaaacacagagtaacgcagta
agtccacccacaaataccccaatatgtgaagccttaaatgggtcattggagcataaagtt
ttctctttaagatccagaccggtatcatttaggccaagaaagacctcagacaacaagatc
accctatttaaacggagacgcagttctgtaaagcaaggggtacgatgtgttaaactgaac
ggacatgtaaaattgacgggtcaacttgttcccagtaaacttcatccaccccctggggct
ggagccaatcacctcactgatgcaatgcactctgaccctaaattgttgctaaagccatat
gtagagttgggactcaacaacaatttaaagagacagtcattgactggtctaccccctagc
acggttttaacaggagacgcctttaatatattacacagcccaccggcatcaaagcagtcg
acggaaggtgcgacgaaaaatgtggcatttaacccattcactccctcaaaaagactgcgg
ctcgtggtcagccatggttctatcgctctagacatggcatccacgtcgagtgaagaaacc
agttaa

DBGET integrated database retrieval system