KEGG   Xiphophorus maculatus (southern platyfish): 102224819Help
Entry
102224819         CDS       T02923                                 

Definition
(RefSeq) prostaglandin G/H synthase 1-like
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00590  Arachidonic acid metabolism
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102224819
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102224819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosducin An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 102224819
NCBI-ProteinID: XP_005798771
Ensembl: ENSXMAG00000005144
UniProt: M3ZSJ4
LinkDB All DBs
Position
8
AA seq 903 aa AA seqDB search
MRASILGSVCALLLLLREPGCRGDEVTTSTVNPCCYLPCQHWSICVRHGEDKYECDCTHT
GYYGENCTVPELWTRVRRFLRPSPDVVHYILTHFQWLWDIINNTFLRNVLMRLVLTVRSS
LIPSPPTFNSKYNYLSWESYSNLSYYTRILPPIPEDCPTPLGVKGKNGLPDPEVLVEKLL
KRRTFRPDPQGSNIMFAFFAQHFTHQFFKTYNRMGLGFTKALSHGVDAGHVYGDNLERQH
NLRLFKDGKLKYQLIDGEMFPPSVVDAPIRMSYPPGVPAERQMAIGQEVFGLLPGLGLYA
TLWLREHNRVCDVLKAEHPTWDDEQLFQTARLIIIGETIRIVIEEYVQHLSGYLLQLKFD
PTMLFHSHFQYANRIALEFSQLYHWHPLMPDTFHINGDELTYAQFLFNTSVLTHYGVEKL
VDAFSRQAAGQIGGGHNMNAIVSKVAVGTIKESRELRIQPFNEYRKRFNLEPYTSFRDFT
DNEEIASTLEELYGDIDTLEFYPGLLLERTRPGAIFGESMVEMGAPFSLKGLLGNPICSP
GYWKPSTFGGKVGFDIVNSATLKKLVCLNSRTCPYVAFNVPAEEKPARKERSSEAAAMTT
LDDKLLGEKLQYYYSSSEDEGSDNDDEDGERKTIRDAGATEPDIEYSADGSAVNTGPKGV
INDWRKYKQLEVEQKQEQKKEMERLIKKLSMTCRSDLDLKKDKEEEKKLQDKIKSKMTMQ
EYNMLQEDEDDEDFLRQYRMQRIEEMRRQLCRGKRFERVQELGGGEEFLEALDKEDKSTL
IMIHIYEPEIPGCDAMSGSLLCLAHEYPLVKFCCVRSSAISISALFRESALPALLVYKGG
DLIGNFVRLTDQLGEDFFAVDLEALLQEYGLLPEKPAMVPKTLRNGAIIQSNASDEDSDL
DID
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgagagcctctatccttggatcagtttgtgctctcctcttgctcctgcgggagcccgga
tgccggggagatgaggttacaaccagcacagtgaacccatgctgttacctcccatgtcag
cactggagcatctgtgtgcgccatggcgaggacaagtatgagtgtgactgcactcacacc
ggatactacggagaaaactgcaccgtccctgaactttggacccgggtgcgtcggttcctc
aggcccagtccagatgtggtgcactacattcttacccatttccagtggctgtgggacatc
atcaacaacacattcttacggaacgtcctcatgcggctggttctgacggtgaggtccagc
ctgatccccagtcctcccactttcaattcaaaatataactacctcagctgggagtcctac
tccaacctcagctactacaccaggatcctgccccctattcctgaggactgccccacgccc
ctaggggtcaaaggcaaaaatggcctccctgaccctgaggttttggttgagaagctgctg
aaaagaaggacattcaggcctgaccctcagggctccaatatcatgtttgctttcttcgct
cagcatttcacccaccagttcttcaagacctacaaccgcatgggtctgggcttcaccaag
gctctgtcacacggggtggatgcgggccacgtttatggagacaacctggaacgtcagcac
aacctccggcttttcaaagatggaaaactgaaatatcagttgatcgatggagaaatgttc
cctccctctgtagttgatgctcccatcaggatgagctaccctcccggggtcccggcggag
agacagatggccattggtcaggaggtgttcgggctccttcccggtttgggtttgtacgcc
acactgtggctcagggagcacaacagagtctgtgacgtcctgaaagcagagcatcctacc
tgggacgatgagcagcttttccagacggcccgccttatcatcatcggcgagaccatacgg
atcgtgatagaggagtacgtgcagcacctgagcggctacctgctgcagctcaagttcgat
cccaccatgctcttccactcccacttccagtacgcgaaccggatcgcgctggaattcagc
cagctctaccactggcacccgctgatgcccgacaccttccacatcaacggagacgagttg
acgtacgcgcagttcctcttcaacacttctgtcctgacgcactacggcgtggagaaactg
gttgatgccttctctcggcaagctgccggccagattggtggaggccacaacatgaacgca
atcgtctccaaagtcgccgtgggaacgataaaggagtctcgcgagctccggatccagcct
ttcaacgagtacaggaagcgttttaacctcgagccatacacatcattcagagacttcacc
gataacgaagagatagccagcaccctagaggagctctacggggacatcgacactcttgaa
ttttaccccgggttactgctggagaggactcgaccaggggcgatatttggagaaagcatg
gtggaaatgggtgcccccttttccctcaaaggcctcctgggtaaccccatatgttcccca
ggatactggaagcccagcacattcggaggcaaagtcggcttcgacattgtgaactcggcc
actctgaagaagctggtgtgcctgaactcccggacgtgtccctacgtggcgttcaatgtt
ccagcagaggagaaaccagccaggaaagaacgaagctctgaagccgctgccatgactact
ctggatgacaagttgctaggtgagaagctgcagtactactacagcagcagtgaggatgaa
ggcagtgacaacgacgatgaagatggggagaggaagaccatccgggatgcgggcgccacc
gagcccgacatagagtacagtgcagacggaagtgctgtcaacacagggccaaagggagtc
atcaacgactggaggaagtacaagcagctggaggtggaacagaaacaggagcagaagaaa
gagatggagagactgataaagaagctgtcgatgacgtgccgctccgatctggacctaaaa
aaagacaaagaggaggagaagaagctgcaggacaaaattaaaagcaaaatgaccatgcag
gagtacaacatgctccaggaggacgaggacgacgaagacttcctccggcagtaccgcatg
cagcgcatcgaagagatgcgccgccagctctgccgcggaaagcgcttcgagcgggtgcag
gagctcggcggcggcgaggagttcctggaggcgctggacaaggaggacaagagcacgttg
atcatgatccacatctacgagccggagatcccgggctgcgacgccatgagcggcagcctg
ctgtgcctggcgcacgagtaccctctggtgaagttctgctgcgtgcgcagctcggccatc
agcatcagcgcgctgttcagggagagcgctctgcccgcgctgctcgtctacaaaggaggg
gacctgatcggtaacttcgtgcggctcaccgatcagctcggggaggacttcttcgccgtg
gacctggaggcgctcctgcaggagtacggcctgctgccggagaagcccgccatggtccca
aagacactgcgcaatggagccatcattcagagcaacgcaagcgacgaggactcggacctt
gacatagactaa

DBGET integrated database retrieval system