Xenorhabdus nematophila AN6/1: XNC2_0636 Help Entry XNC2_0636         CDS       T03752                                  Name (GenBank) conserved hypothetical protein   KO K05375   MbtH protein Organism xnm  Xenorhabdus nematophila AN6/1 Pathway xnm00261   Monobactam biosynthesis xnm01100   Metabolic pathways xnm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xnm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     XNC2_0636  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:xnm01008]     XNC2_0636 Polyketide biosynthesis proteins [BR:xnm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     XNC2_0636 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CEK21632 LinkDB All DBs Position I:563020..563202 Genome browser AA seq 60 aa AA seqDB search MKQLTGNDAMNWMVVLNGKKQYSVWPTEYDIPVGWMATGRTGSKDDCLNHIAAIWPEPTK NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgaaacagttaaccggaaacgatgccatgaattggatggttgtgctcaatggtaaaaag cagtattcggtctggccgacggaatatgacattccggtggggtggatggcaacgggcaga acgggatctaaagatgattgcctgaatcatattgctgccatttggccggaacccacaaaa tag

DBGET integrated database retrieval system