KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3485
Entry
XOO3485           CDS       T00235                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
  KO
K11892  type VI secretion system protein ImpK
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XOO3485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xoo02044]
    XOO3485
Secretion system [BR:xoo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XOO3485
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AAW76739
UniProt: Q5GX32
LinkDB
Position
3735367..3736158
AA seq 263 aa
MMNPLPPTPGPMPSLTAQAPHGLPSAHTSTPQSLLDLMADGFYLLLLLKRTQMPSDTESF
VQSVQTFLDGVERGAVKLGIASEDIYAAKYAFCAAVDEAILSQPSALHETWERNPLQLRL
FGEHLAGEHFFDRLEELRRQGAVRLPSLEIYHYCLLLGFEGKYRLEGPEKLGYLTARLGD
EIVYFKGKRSGFAPHWPPPDNVRHALRRVVPLWLPAALVTGFGLLGFFGLRLSLDHQTER
RMAAYNQVVQMPQRTAHITITLP
NT seq 792 nt   +upstreamnt  +downstreamnt
atgatgaacccgctgccccccacccccggcccgatgccgtcgctgaccgcgcaggcaccg
cacggcctgccgagcgcccatacctccacgccgcagagcctgctcgacctgatggccgac
ggcttctacctgttgctgctgctcaagcgcacgcagatgcccagcgacaccgaatccttc
gtgcagtcggtgcagacattcctcgatggcgtggaacgcggcgcagtcaagctcggcatc
gcctccgaggacatctacgcggccaaatacgcgttctgcgcggcagtagacgaagcgatc
ctgtcgcagccctcggcactgcacgaaacctgggaacgcaatccgctgcagctgcgcctg
ttcggcgaacacctggccggcgagcatttcttcgatcgcctggaagagctgcgccgccag
ggcgccgtgcgcctgccctcgctggagatctaccactattgcctgctgcttggcttcgaa
ggcaagtatcggctggaagggccggagaagctcggctacctgaccgcgcggctgggcgac
gagatcgtctatttcaagggcaagcgcagcggtttcgcaccgcattggccgccgccggac
aacgtgcgccatgccttgcgccgtgtggtgccgctgtggctgccggccgcgctggtgacc
ggcttcggcctgctcggcttcttcggtctgcgcctgtctctggaccaccagaccgagcgg
cgcatggccgcctacaaccaggtggtgcagatgccgcaacgcaccgcgcacattacgatc
accctgccgtga

DBGET integrated database retrieval system