KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3489
Entry
XOO3489           CDS       T00235                                 

Definition
(GenBank) unknown protein
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
SSDB
Other DBs
NCBI-ProteinID: AAW76743
UniProt: Q5GX28
LinkDB
Position
3743897..3746152
AA seq 751 aa
MTSMLISYPILPANAANQSDQAKFDAMVALTQPTRGLYPITTGNRWHGGIHLTPGTEPIR
AIADGVIVAYRLAPATKDYPGQGLYDTSFVLIKHDTHSGENTQVVYYSLYMHLAPKGSLT
DAQRSQMMPFLRNAATGESATQAPANTRVWRKEVLGFGGQLYGVPTVHFEIFTTEADLAR
FWRDASAVAAGGHGSNDVFGDTHFILPANLNFVARHPHAVAPHRIDLPGHDQFYELPIGI
AGQSTERLHVVVELSKGHRIATTYRLDAQGKLAGQIGLPLRQDDYEYEIFRLATKLYADC
PSAGYEYLRFGRILSSDTTTHTENWQLIRYAENAIGYINLADPGNNVIVLSDADFPDSWQ
KLSEGRAASPEDGIANVDGLTQLLNLPASPSEPSLSAAPSFLSRASDASVIKLLRHFICK
HPSEWDTSDIDTRYAVLKQPGKPLNDPTAWKNFKDHVEAMAFWPQTGLADRSVWHFHPLT
FINHYMKCGWLSVNEFARCLPRRSLSDRNLVWNTALTRATTHSIHYNKYIRKFCGNSRKR
LAHNLAQSYIETGILSLMEEGGAGNGHPYTAFFGRGYHQLTWAGNYRGYGEFKNLPQHTG
AYSDRRITRTSQHPLDSGGTLITWSPRYDPATISSDLDHAGESSGFFWASKSFRGKKNMN
RVADLEFNESSVGFCCWLINGGGAGYSNRQQFAKFLANILLDEPLKSGQVNFTYPALSPP
GNPALCTSFPPATVPYTERQIIDYEPQIPPV
NT seq 2256 nt   +upstreamnt  +downstreamnt
atgacatcaatgcttatcagctatcccattttgcctgccaacgcagccaatcaaagcgac
caagcaaagttcgatgcgatggtggcgcttacacaaccgaccagaggactctacccaatc
acaacgggaaaccgctggcacggcggcatccaccttacaccgggaaccgagcccatacgt
gcgatcgctgatggcgtcatcgtcgcctatcgcctggctccggcaaccaaagactatcca
ggacagggcctttacgacaccagtttcgtgctgataaagcacgatacgcatagcggtgaa
aacacgcaggtcgtgtactactcgctatacatgcacctcgccccgaaaggctcgcttacc
gacgctcagcggtcacagatgatgccgttcctgcgaaatgcggcaactggcgaatcggcc
acgcaagcacctgccaatacccgggtttggcggaaggaagtactcggcttcgggggccag
ctttacggcgtaccgacggtgcacttcgaaatattcaccacggaagcagaccttgcgagg
ttctggcgggacgccagcgctgtcgctgcaggtggacatggctccaatgatgtcttcggg
gatacccacttcatcctcccggccaatctcaacttcgtagcacgccatccgcatgccgtc
gctccacaccgcatagacctacccgggcatgaccaattctacgaactgcccattggcata
gcaggccaaagcactgaacgcctacacgtggtagtagaactaagcaaaggacatcgcatt
gctaccacttatcgcttggatgctcaaggaaagctcgcagggcagatcggtctccccttg
aggcaagatgactatgagtacgaaattttccgactggcaacgaaactttacgcggattgc
ccaagtgcaggatatgaatacctgcgctttggtcgtattttgagcagcgacacaacaacg
catacagaaaactggcaattgatccgatatgccgaaaacgctatcggctacatcaacttg
gctgatcctgggaataacgtcattgtactttcggacgcggactttcctgactcttggcaa
aagctatccgaaggccgggcagcgagccctgaggatggcatcgcaaacgtagatggctta
actcaacttcttaacttacctgcatcgccatctgagccatccttgtcggctgcaccaagc
tttctgtcacgggctagtgacgccagtgttattaagctgctgcggcattttatttgcaaa
catcctagtgaatgggatacaagcgatatcgacaccagatatgccgtgctgaagcaaccg
ggtaagccacttaacgatcccactgcttggaagaacttcaaagaccacgttgaagcgatg
gcgttttggcctcagacaggcttagcagaccggagcgtctggcatttccatcctttgact
ttcataaaccactacatgaaatgtgggtggcttagcgttaatgagtttgctagatgctta
ccaagacgcagcctttcagatcgcaacttagtctggaatacggcattgactagggcaacg
acacattcgattcattacaacaaatacatacgcaagttttgtggcaactccagaaaaagg
ctcgctcacaacctagcccaaagttatatcgaaacgggaattttatccttaatggaagaa
ggaggagccggcaatgggcatccgtatactgctttttttggcaggggctaccatcagtta
acatgggctggcaattatcgaggatacggcgagttcaaaaacctcccacagcatacaggc
gcttactctgacagaagaattacccgaacatcacagcaccccctggactcgggaggaaca
cttatcacatggtcaccacgctatgatccggcgacaatctcatccgacctcgatcacgct
ggagaatccagtggatttttctgggcatccaaaagctttcgaggcaaaaaaaatatgaac
cgagttgcggacttggaatttaatgagtcatcagtagggttctgttgctggcttattaat
ggtggtggggcaggctattctaaccgacagcaatttgctaagtttctcgccaacatcctt
cttgacgaaccattaaaatctggccaagttaactttacctaccccgcattgtcaccacca
gggaaccctgcactctgtaccagcttcccccctgcgacagtcccttacacagaaaggcag
atcatcgattatgaacctcaaattcctcctgtgtag

DBGET integrated database retrieval system