KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02047
Entry
PXO_02047         CDS       T00763                                 

Definition
(GenBank) Hcp family protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xop00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PXO_02047
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xop02044]
    PXO_02047
Secretion system [BR:xop02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PXO_02047
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACD60330
UniProt: A0A0K0GN93
LinkDB
Position
complement(3863106..3863603)
AA seq 165 aa
MQHAFLSIDTIKGESHDDKHTDWVEIKSFSQDLLQPRSATASTAGGQSAARVNLSPIEIV
KSIDLSTTALNQACANGTTFPKARIEFMRADKDGNAINYYLVELMNVLVHRVTTTVDEDG
MPQEVVQLSFGAIKWTYNQQKPEGGVGGKAVAQWSATKNIPNYTV
NT seq 498 nt   +upstreamnt  +downstreamnt
atgcagcacgcgtttctttctatcgataccatcaagggtgaatcgcacgacgacaagcac
acggactgggtggagatcaagtcgttctcccaggacttgttgcagccgcgctcggccacc
gcatccaccgctggcggtcagtcggccgctcgtgtaaacctgtcgccgatcgagatcgtc
aagtcgatcgatctgtccaccaccgcgctgaatcaggcgtgcgccaacggcaccaccttc
cccaaagcccgcatcgagttcatgcgcgccgacaaggacggtaatgccatcaactactac
ctggttgagttgatgaacgtgctggtacaccgcgtcaccacgacggtggacgaggacggc
atgccgcaagaagtcgtccagctgagcttcggcgcgatcaagtggacctacaaccagcag
aagccggaaggcggagtcggcggcaaggcggttgcgcagtggagtgctaccaagaacatt
cccaactacaccgtttga

DBGET integrated database retrieval system