KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_04590Help
Entry
PXO_04590         CDS       T00763                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
KEGG Orthology (KO) [BR:xop00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PXO_04590
Enzymes [BR:xop01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PXO_04590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like DAO FAD_binding_3 NAD_binding_7 Glutaredoxin FMO-like K_oxygenase Thi4 Thioredoxin_4 AlaDh_PNT_C NAD_binding_8 Spermine_synth
Motif
Other DBs
NCBI-ProteinID: ACD57824
UniProt: A0A0K0GHW4
LinkDB All DBs
Position
complement(1189752..1191344)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLTAYLERVTRPIQINASIDESPGSREMLDLLEELVLLSDKISLDIHRDDDQ
RKPSFALTTPGQDIALRFAGLPMGHEFTSLVLALLQVGGHPSKAAAELIEQVQHLDGDYR
FETYFSLSCQNCPDVVQALNLAAVLNPRIKHVAIDGAWFQDEVETRQIMSVPTVYLNGEL
FDQGRMTLEQIVAKLDTNASKRDAAKIAAKGAFDVLVVGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYEVDIMNLQRAEQLIPAGADG
LIEIKLANGASLKSKTVILSTGARWRQMNVPGEDQYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADDVLQRKLRSLHNVRIITSAQTTEVLGDG
QKVTGLVYKDRTGGAIQHFDLEGVFVQIGLLPNTEFLRGTVALSPRGEIIVDDRGQTDVP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDHLIRSSAPATADNVAQAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatctcaagacccagctgaccgcctacctggaacgggtgacgcggccg
attcaaatcaacgcatcgatcgacgaaagccctggttcgcgcgaaatgctcgacctgctg
gaagagttggtgctgttgtcggacaagatcagcctggacatccaccgcgacgacgaccag
cgcaagccctcgttcgcgctgaccacgccgggccaggacatcgcgctgcgtttcgccggg
ctgccgatgggccatgaattcacctcgctggtgctggcgctgctgcaggtgggcggccac
ccgtccaaggcggctgccgaactgatcgagcaggtgcagcacctggatggcgattaccgg
ttcgaaacctatttctcgctgtcgtgccagaactgcccggacgtggtgcaggcgctgaat
cttgccgccgtgctcaacccgcgcatcaagcacgtggccatcgacggtgcgtggttccag
gacgaagtggaaacccgccagatcatgtcagtgcccaccgtgtatttgaacggcgagctg
ttcgaccagggccgcatgacgctggagcagatcgtcgccaagctcgacaccaacgcgtcc
aagcgcgacgctgcgaaaatcgccgcgaaaggggcgttcgacgtgctggtggtgggcggt
ggcccggccggtgcggcagcagcggtgtatgccgcgcgcaagggcatccgcaccggcgtg
gcggccgagcgtttcggtggccaggtgctggacaccatgtcgatcgaaaacttcatctcc
gtgccggaaaccgaaggcccgaagatggccgccgcgcttgagcagcacgtgcgtcagtac
gaggtggacatcatgaacctgcagcgcgccgagcaactgattccagccggtgccgatggc
ctgatcgaaatcaaactcgccaatggcgcctcgctcaagagcaagaccgtgatcctgtcc
accggtgcgcgctggaggcagatgaacgtgcccggcgaagaccaatacaagaacaagggt
gttgcgtattgcccgcattgcgacggcccgctgttcaagggcaagcgcgtggcagtgatc
ggcggcggcaactccggcgtggaagcggcgatcgatctggccggcatcgtggcgcatgtc
acgctagtggaattcgacgacaagctgcgcgccgatgacgtgctgcaacgcaagctgcgc
agcctgcacaacgtgcgcatcatcaccagcgcgcagaccaccgaagtgctcggcgacggg
cagaaggtgaccggcctggtctacaaggaccgcaccggtggcgctatccagcacttcgat
ctggaaggcgtattcgtgcagatcggcctgctgcccaacaccgagttcctgcgtggcacg
gtagcgctgtcgccgcgcggcgagatcatcgtcgacgaccgcggccagaccgatgtgccg
ggcgttttcgccgccggcgacgctaccacggtgccctacaagcagatcgtgatcgcgatg
ggcgaagggtccaaggcggccctgagcgcattcgatcatctgatccgctccagcgcaccg
gccactgccgataacgtggcccaggccgcataa

DBGET integrated database retrieval system