KEGG   Xanthomonas perforans: BJD13_04450Help
Entry
BJD13_04450       CDS       T04778                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xpe  Xanthomonas perforans
Pathway
xpe00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xpe00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BJD13_04450
Enzymes [BR:xpe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BJD13_04450
Transporters [BR:xpe02000]
 Other Transporters
  Pores ion channels [TC:1]
   BJD13_04450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: APO98409
UniProt: A0A0G8UF26
LinkDB All DBs
Position
649676..650374
Genome map
AA seq 232 aa AA seqDB search
MITVHHLNNSRSQRVLWLLEELALPYQIVRHERDPKTMLAPPALRAIHPLGKSPVLVDGD
LVVAESGAILEYLTERYDTECALSPSPRPLDSPERLQFRYWMHYAEGSAMPPLLMTLIFG
RIRSAPMPFFAKPIARAIVDKAMSGFVGPQLTLHLNWMEQSLQAGNWFAGERFTAADIQM
SFPVQAAAARGGGLENYPRLRAFLERIQARPAYQAALKKGGPFELMGSKPAN
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgtccaccatctcaataattcccgttcccagcgcgtgctgtggctgctggaa
gaactggcgctgccttaccagatcgtgcgccatgaacgcgaccccaagaccatgctggcg
ccgccggcgctgcgcgcgatccatccgctgggcaaatcgccggtgctggtcgatggcgac
ctggtcgtagccgaatctggggcaatcctggagtacctgaccgagcgctacgacaccgag
tgcgcgctgtcgccatcgccgcggccgctggattcgcccgagcgcctgcagtttcgctat
tggatgcattacgccgaaggctcggcgatgccgccgttgctgatgacgctgatcttcggt
cgcatccgcagcgcgccgatgccgttcttcgccaagcccatcgcacgtgcgatcgtggac
aaggcgatgtcgggtttcgtggggccgcagctcaccttgcatctgaactggatggagcag
tcgttgcaggccggcaactggttcgctggcgaacgcttcaccgccgccgacatccagatg
agcttcccggtacaggcggcggccgcacgcggcggcggtctggagaactacccgcgtttg
cgcgcgtttctggaacggatccaagcgcgtccggcgtatcaggctgcgctgaagaaaggc
ggcccgttcgagctgatgggaagcaagccggccaattga

DBGET integrated database retrieval system