KEGG   Xenopus tropicalis (western clawed frog): 100038110
Entry
100038110         CDS       T01011                                 

Gene name
dnajc27
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00230  Purine metabolism
xtr01100  Metabolic pathways
xtr04020  Calcium signaling pathway
xtr04114  Oocyte meiosis
xtr04261  Adrenergic signaling in cardiomyocytes
xtr04270  Vascular smooth muscle contraction
xtr04371  Apelin signaling pathway
xtr04540  Gap junction
xtr04912  GnRH signaling pathway
xtr04914  Progesterone-mediated oocyte maturation
xtr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100038110 (dnajc27)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100038110 (dnajc27)
   04020 Calcium signaling pathway
    100038110 (dnajc27)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100038110 (dnajc27)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100038110 (dnajc27)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100038110 (dnajc27)
   04914 Progesterone-mediated oocyte maturation
    100038110 (dnajc27)
   04916 Melanogenesis
    100038110 (dnajc27)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100038110 (dnajc27)
   04270 Vascular smooth muscle contraction
    100038110 (dnajc27)
Enzymes [BR:xtr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100038110 (dnajc27)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N Pilin_N
Other DBs
NCBI-GeneID: 100038110
NCBI-ProteinID: NP_001096154
Xenbase: XB-GENE-490420
UniProt: A2VCZ2
LinkDB
AA seq 1116 aa
MPRNRAFSEPEYSAEYSADYSVSLPSDPEHGVGRTHEVTVRSSGCCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVIVMCAVVYSNDKLASTLVAVVGLLAHLL
LFVLCKFGLLPDRISRKFVPYILWILIAAQIFSYLGLNFAHFHEASDTVGWQAFFVFSFF
ITLPLRLTPIVLITAVSCGIHTLVLGVTIAQQQQDSINGNALLRQILSNVAIYLCTITVG
IMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLKDMKKDQK
QKELQQFNTMYMYRHENVSILFADIVGFTQLSSYCSAQELVKLLNELFARFDKLAAKNHQ
LRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVDAISYVREKTKTDVDMRVGVHSGTV
IGGVLGQKRWQYDVWSTDVTLANKMEAGGIPGRVHISQSTYDCLKGEFEVEPGEGGTRCD
YLREKGIVTYLVIVPKQPINKNGINGVKLSLTSSHGNSPQLINTKECNGSIHTTCTTPDE
NEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQQNEQELNKLLNEALLERETVQVLKGKY
TYRLSMRFINPEMETRFSVEKEKQSGAAFSCSCVVLLFTAIVQILIDPMLIANYVTFVIG
EILLLVLTICSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMSAIFILTMADIVDMLSC
LQYYGTLNITSPAQEAWGCVENPKYYSYIAVLALIATIMLVQVSHMVKLTLMLMITIAVG
VVNIYAWRPIFDDYDSKRFNGYLALLVPSKYSMTAMIFVMMLSFYYFARHVEKLARTLFL
WKIDVHEQKEKVYDMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVMFASI
PNFSDFYTEESINNGGIECLRFLNEIISDFDALLDEPQFRCITKIKTIGSTYMAASGVTP
DSNANGYNNTIKKEEISDKERWQHLADLADFALAMKVTLMNINYQSFNNFMLRIGLNKGG
VLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHDVLKEYGFRFVRRGPIYV
KGKGELLTFFLKGRDKQGSFINGSSVTLPHQVVDNS
NT seq 3351 nt   +upstreamnt  +downstreamnt
atgccccggaaccgagccttttccgagccggagtactctgcggaatattcggcggactat
tcggtgagtttgccgtcggacccggagcatggggtcggcaggacgcacgaggtcaccgtc
cggagctccggttgctgcctctgcttgccgcgctttatgcgcctcacctttgcgccggag
tccttggagaacctctaccagacgtactttaggcggcagcggcacgagacgcttttggtc
ctggtggtcttcgccgccctcttcgactgctacgttatcgtcatgtgcgccgtggtgtat
agcaacgacaaactggcgtcgaccttggtggcggtggtggggctcttggctcacctcttg
ctcttcgtcctatgcaagtttggcttgttaccggaccgcatctcccgtaagttcgtcccc
tacatcctgtggatcttgatcgccgcccagatcttctcttacttgggcctcaactttgca
cacttccacgaggccagtgacacggtgggttggcaggccttctttgtcttctccttcttc
atcactctgcctcttcgtctcacccccatcgtcctcatcacggcggtgtcctgcggcatc
cataccctggtgttgggcgtcaccatcgctcagcagcagcaggattccatcaatggcaat
gccttgttacggcagatcctgtccaacgtcgccatctacctgtgcaccatcaccgtgggc
atcatgtcgtactacatggccgaccgcaagcaccgcaaagcttttctggaagcccgccag
tctctcgaggtcaaactcaacctggaagaacaaagtcagcagcaggagaggctccttctg
tccatcctgcccaagcacattgccgacgagatgctgaaggacatgaagaaggaccagaag
cagaaggaacttcagcagtttaacaccatgtacatgtacagacatgagaatgtcagcata
ctcttcgctgacattgttggatttacgcagctgtcgtcgtactgtagcgcccaggaactg
gtcaagctgctcaatgaactctttgcccgattcgacaaactggcagcgaaaaaccaccag
ctgcgcattaagattttgggcgactgttactactgcatctgcggcctccccgactaccgg
gaggatcacgctgcctgctccataatgatgggacttgctatggtggatgccatatcttac
gtgagagagaagacaaaaacagatgtggatatgcgcgttggagtccattcagggacagtc
atcggcggggtcctggggcagaaacgctggcaatatgacgtttggtccacagatgtcacc
ttggccaacaagatggaggctggaggcataccaggaagagtccatatttcccaaagtacc
tacgactgcctgaagggggagtttgaggtggagccaggggaagggggtacaaggtgcgac
tatctaagagaaaagggcatcgtgacctaccttgtcatcgtaccaaagcagccaataaac
aagaatggcatcaacggggtgaagctgtcgctgacgtcgtcccacgggaactctccgcag
ctcattaacaccaaggaatgcaatggcagcatccacaccacctgtaccactccagatgag
aacgaggagctggacactagggtagtgaatccatctttccccaacccgcgccgacgcctg
cgcctccgagacttggccgagagggtcattgatgctcagcagaacgagcaggaactcaac
aaacttctcaatgaggctctgctggagagagagactgtgcaagtccttaaagggaaatac
acctaccgcttgtccatgcgctttatcaacccagagatggagacgcggttttctgtagag
aaagagaagcagagtggagctgccttcagttgttcctgcgtcgtgctgctattcacggcc
atcgtgcagattctcatcgaccccatgcttattgccaactacgtgaccttcgttattggt
gaaatcctgcttctagttctgaccatctgttcgcttgcagccatttttcccagggttttt
ccaaaaaaattagttgccttttctacatggattgatcggacaaggtgggctcgtaacaca
tgggcaatgtccgccatattcatcctgacgatggcagatatagtggatatgctcagctgc
ctgcagtactacggcactctcaatattacgtcccccgctcaagaagcttgggggtgcgtt
gagaaccccaagtattacagttacattgccgtcctggctctcatagccaccatcatgctg
gtgcaagtcagccacatggtcaagctaacgctcatgctgatgatcaccattgccgtcggc
gtggtcaacatttacgcctggagaccgatctttgacgattacgacagcaagaggttcaac
ggctacttggctcttttggttccttccaaatactccatgactgccatgatcttcgtcatg
atgctcagcttctactactttgcccgacacgtggagaagttggccaggacgttgttcctt
tggaagatcgatgtccatgaacagaaggagaaggtttatgacatgcggcgctggaacgaa
gctctggtcacaaacatgctgcccgaacacgtcgctagacacttcttgggatccaagaaa
cgagatgaggagctctacagccagtcatatgacgaaatcggggtaatgttcgcatccatc
ccaaacttctctgacttttatacagaagaaagcatcaacaacggaggcattgagtgcctg
aggttccttaatgagattatttccgatttcgatgcgctgttagatgaaccccagttccgt
tgcataacaaagataaagaccatcggcagcacgtacatggcagcttccggggtgactcca
gattccaatgccaatggatataacaacactataaagaaagaggaaatctcggacaaagag
cgctggcagcaccttgccgacctggcagactttgccctcgccatgaaagtgacactaatg
aacataaactaccagtcatttaacaacttcatgctccgaataggtttaaataaaggtggt
gtacttgcgggtgtcattggtgcacgaaagcctcattacgacatctgggggaatacagtg
aatgtcgctagtaggatggaatctacaggagtcatgggaaatatacaggttgtagaagaa
acgcatgacgttctcaaggaatacggattccgctttgtgagacgaggtcccatctacgtt
aagggtaaaggcgagctgctgacgttcttcctcaaaggacgggacaagcaaggttccttc
atcaatgggtcttcggtcaccctgccgcaccaagtggtggacaattcctga

DBGET integrated database retrieval system