KEGG   Xenopus tropicalis (western clawed frog): 100271763Help
Entry
100271763         CDS       T01011                                 

Gene name
lig1, ligI
Definition
(RefSeq) ligase I, DNA, ATP-dependent
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr03030  DNA replication
xtr03410  Base excision repair
xtr03420  Nucleotide excision repair
xtr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100271763 (lig1)
   03410 Base excision repair
    100271763 (lig1)
   03420 Nucleotide excision repair
    100271763 (lig1)
   03430 Mismatch repair
    100271763 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xtr03032]
    100271763 (lig1)
   03400 DNA repair and recombination proteins [BR:xtr03400]
    100271763 (lig1)
Enzymes [BR:xtr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100271763 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     100271763 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100271763 (lig1)
DNA replication proteins [BR:xtr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100271763 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100271763 (lig1)
DNA repair and recombination proteins [BR:xtr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100271763 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     100271763 (lig1)
   MMR (mismatch exicision repair)
    Other MMR factors
     100271763 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme DDR
Motif
Other DBs
NCBI-GeneID: 100271763
NCBI-ProteinID: XP_002941929
Xenbase: XB-GENE-1009779
LinkDB All DBs
Position
7
AA seq 1040 aa AA seqDB search
MQRTIKSFFQPKLGAEVKKKEENVKHDDTKKEKVEEPEKSVNTERPLKERNGSALCDDAE
SPVKKVSKKSARVLESDSEEEEENSKVQATPEKMNNDSVPKNDAVEETPQRAHKETKVEG
TSEMNTSQDFTSPCSSKSIDSPLCSDSPGISPSGIPKRKTARKQLPKRKLENSPSESNPP
TEDVKVQGAVKRQRKEAEGNVQQEEPMETGHNISMEEECSIKKEANAEVVQEEKSKVDDQ
NVELLDQKDDVSGREQSEPKDKELQPKSTSPNSKPKTPKAKSGKKHSPLQKKVKFSDKVS
SKDDSEGKSSEEKSDEEPEKKADPAKPVKQISSFFAPKKPAIKTEKKEEIMNEKNASETS
LEASPKPKKTVSSFFGAIKPEPSEDQAVYNPSKSSYHPINDACWSNGQKVPYLAVARTFE
RIEEESARLKNIETLSNFLRSVIALTPGDLLPCIYLCLNRLGPAYEGLELGIGETILMKA
VAQATGRQLEKIKSEAQEKGDLGLVAESSRSNQRTMFTPPKLMASGVFSKLKDIARMTGN
ASMNKKIDIIKGLFVACRHSEARYIARSLGGKLRIGLAEQSVLSAIAQAVCLTPPGHDAP
PTVMDAGKGMSTDARKSWIEDKAMILKQTFCELPNYDAIIPILLEHGIDDLPKHCRLTPG
IPLKPMLAHPTKGIGEVLKRFDEAAFTCEYKYDGERAQIHILENGEVHIYSRNQENNTTK
YPDIISRIPKIKKESVKSCILDTEAVAWDPEKKQIQPFQVLTTRKRKDVDASEIKVQVCV
YAFDMLYLNGESLVKEPFAKRRQLLRDSFLETEGEFMFATYMDTSNTDEISEFLDQSIKD
SCEGLMVKTLEQDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIGAYLGKGKRTGIYGG
FLLASYDEESEEYQTICKIGTGFTDEDLEKHYNYLKDHVIDSPRSYYRWDSATEPDHWFD
PVQVWEVKCADLSISPVHKAALGLVEDEKGISLRFPRFLRIRDDKKPEEATNSFQVADLY
RKQQQIQNTTTTEKGEEDFY
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgaacaatcaagtccttttttcagcccaaacttggggctgaagtaaagaaaaag
gaagagaatgtgaagcatgatgatactaaaaaagaaaaggtcgaagagccagagaaaagt
gttaatactgaacgtcctctaaaagagagaaatggcagtgctttgtgtgatgatgccgaa
tcacccgtcaaaaaagtttcaaagaagtctgcacgtgtgttggaaagtgatagtgaagag
gaagaggaaaactcaaaggtacaagcgactcctgaaaaaatgaacaatgatagtgtacca
aagaatgatgcagttgaagaaactcctcagagagcacataaggaaacaaaagttgaagga
acttcagagatgaacacttcacaagattttacttctccttgcagcagcaaatctattgac
agccctttatgttcagattctcctggcatatctccatctggtatccccaaaagaaagaca
gcccggaaacaactaccaaaacgtaagctggaaaattctcccagtgaatcaaatccaccc
acagaggatgtaaaagttcaaggagcagtgaagcgccaaaggaaagaggcagagggaaat
gttcaacaagaagaacccatggagacaggtcacaatatctccatggaagaggaatgctcc
ataaagaaagaggcaaatgctgaagtggttcaagaagaaaaatccaaagtggatgatcag
aatgtggaacttttagaccaaaaggatgatgtttcaggaagagaacaatctgagcctaaa
gataaagaactgcagcctaaatctaccagtcctaattccaagccaaaaacgccaaaggca
aagtcaggaaagaaacacagtccattgcaaaagaaagtgaaatttagcgataaggtatct
tcaaaagatgacagtgaaggaaaaagtagcgaggaaaaaagtgatgaggagcccgagaag
aaagcagatcctgctaaacccgtgaaacaaataagcagcttctttgccccaaagaaacct
gcaataaagacagaaaaaaaagaggaaattatgaatgaaaagaatgcaagtgagacctct
ttggaagcatcccccaaacctaaaaagacagttagcagtttctttggagcaataaagcca
gaaccatcagaagaccaggcagtgtataacccatccaagagtagttatcaccccataaat
gatgcttgctggtctaatggacagaaggtgccataccttgctgttgcacgaacctttgag
aggatagaagaggaatctgcacgacttaagaacatagagactctcagtaattttctgcgc
tccgtcattgctctcactcctggggacctcttgccttgcatctatctttgtctgaaccgc
ttgggacctgcctatgaaggactggagctcggcataggagaaactatattgatgaaagca
gttgcccaggctacaggacgccagcttgagaaaataaagtctgaggcacaagagaaagga
gaccttggcctggttgctgaaagtagtcgtagcaaccagcgcactatgtttacaccccca
aagctcatggcatcaggtgtttttagcaagctgaaagatatagccaggatgactggcaat
gcttctatgaataaaaaaattgatattattaaaggactgtttgtagcctgcaggcattct
gaggcacgttatattgccagatctcttggaggaaaacttcggattggtctggcagagcag
tcagtgttatcagcaattgctcaggcagtgtgcctgactcctcctgggcacgatgcccct
cctactgtgatggatgctggaaagggaatgagtacagatgccagaaaatcctggatagaa
gacaaagcaatgatcttgaaacaaactttttgtgagttgccgaactatgatgccataatt
cctatccttttggaacatggtattgatgacctcccaaaacactgccgacttactccaggg
atccctttgaaaccaatgttggcgcatccaaccaagggtattggggaagtgctaaagcga
tttgatgaagctgcctttacgtgtgaatacaagtatgatggggagcgtgcacagatacat
attctggaaaatggggaggtacatatatatagcagaaaccaagaaaacaacaccactaaa
taccctgacatcatcagcagaattcccaagattaaaaaagaaagcgtcaaatcctgtatc
ctcgatacagaggctgtagcctgggacccagaaaagaagcaaattcagccgtttcaagta
ctgactactagaaagagaaaggatgtggatgcatcagagattaaagtgcaagtttgtgtg
tatgcctttgacatgctttaccttaatggagagtccctagtgaaagagccatttgctaag
cgacgacagctcttgagggattcgttcctggagacagaaggggagtttatgtttgctacc
tatatggatacatcaaatacagatgaaatttctgagtttcttgatcagtctattaaagat
tcatgtgaaggacttatggtgaagacactggagcaagatgctacatatgaaattgcaaag
cgatctcacaattggttaaaactaaagaaggattacctggaaggtgtgggtgatacactg
gatctggttgttattggagcttacctaggaaaaggaaaaagaacgggtatttatggaggc
ttcctgcttgcgtcatatgatgaggaaagtgaagaatatcagaccatctgcaagattgga
acaggttttactgatgaagacttagaaaagcattacaactacctgaaggatcatgttatt
gacagcccacggagctactaccggtgggacagcgccacagagccggatcactggtttgat
cctgtacaagtctgggaagtgaaatgtgctgatctgtccatttctccagtacataaggca
gctcttggattggtggaggatgagaagggaatttccctgcgatttcctcgcttccttcgg
atcagagacgataagaaaccagaggaggccacaaacagttttcaggtagcagatctttat
agaaagcagcaacaaatccaaaacacaactacaacagagaagggagaagaggatttctac
tag

DBGET integrated database retrieval system