KEGG   Xenopus tropicalis (western clawed frog): 100487430
Entry
100487430         CDS       T01011                                 

Gene name
tgfbr2.2
Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04060  Cytokine-cytokine receptor interaction
xtr04068  FoxO signaling pathway
xtr04144  Endocytosis
xtr04218  Cellular senescence
xtr04350  TGF-beta signaling pathway
xtr04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100487430 (tgfbr2.2)
   04350 TGF-beta signaling pathway
    100487430 (tgfbr2.2)
   04068 FoxO signaling pathway
    100487430 (tgfbr2.2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100487430 (tgfbr2.2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100487430 (tgfbr2.2)
  09143 Cell growth and death
   04218 Cellular senescence
    100487430 (tgfbr2.2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100487430 (tgfbr2.2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xtr01001]
    100487430 (tgfbr2.2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100487430 (tgfbr2.2)
Protein kinases [BR:xtr01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100487430 (tgfbr2.2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal
Other DBs
NCBI-GeneID: 100487430
NCBI-ProteinID: XP_031749455
Xenbase: XB-GENE-876698
LinkDB
Position
9
AA seq 535 aa
METSLGATGVTVLLLSFMAASHNNMRTNVCKWCDHSHPVCDGGVCLTNCSLSSYCENPEE
ICVTVWKEENESLQLSTRCHHPLLLLENFLVPNYNSTLCVMSAVPSVSGRLYTCACTEEQ
ECNDKLIFYNQSNGFSMLHSREAVPVAAISLLPPFLCAVMVTVLFYLYRTQRLSKIPHSW
ADKGGQCPEEAGGRDGYNSVLMGTSEMSPTCAHSMKHKAELLPIELEQRVGKGRFAEVWR
ARLRGGAAGQYETVAVKIFPFQEFPSWRNESRIFADANLKHENVLRFITTETRGTGLRRE
YWIITAFHARGNLKDYLAGHLLNWATFLRMSGSIVSGVAHLHSDSAPCGAAKVPIAHRDI
KSTNILVRSDCRCLVCDFGIAVRLDPALTSEDLANSGQVGTARYMAPEVLESRVNLEDLE
SFKQMDVYSLSLVLWELGTRCDASGETRSYELPFGSKVREQPCVETMRDLVLHGRVRPEI
PPSWGSHPGLNILRDTITECWDHDPEARLTAHCVAERFKLMAQTDCDPSNHHSTD
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggagacctctttgggtgcaacgggggtcactgtgctgctcctgagcttcatggccgcc
tcccacaataacatgaggaccaatgtgtgcaagtggtgtgaccactcccaccctgtgtgc
gacgggggcgtctgtctgaccaactgctccctcagctcctactgtgagaatccggaggaa
atctgcgtcaccgtttggaaggaggaaaatgagagtctccagctcagcacccgctgtcac
caccccctcctactgctggagaacttcctggtgcccaactacaactccaccctctgcgtc
atgagcgccgtgccctccgtatccggccgactgtacacgtgcgcctgcaccgaggagcaa
gagtgtaacgacaaactcatcttctacaaccagagcaacggattttccatgttgcacagc
cgggaggcggtacctgtggctgcaattagtctcctccccccgtttctgtgcgcggtgatg
gtgacggttctgttctacctgtaccgaacccaaaggctcagtaagataccccactcctgg
gcagacaaaggggggcagtgcccggaggaggccggtgggagggacgggtacaactcggtt
ctgatgggcacctcagaaatgagccccacatgcgcccacagcatgaagcacaaggcggag
ctgctgcccatcgagctggagcagcgggttggcaaggggcgctttgcggaggtttggcgg
gccaggctgcggggcggggcggccgggcaatacgagacggtggccgtgaagatcttcccc
ttccaggagtttccttcttggagaaatgagagtcggattttcgccgacgccaacctgaaa
cacgagaatgtgctgcggttcatcaccacggaaacccgcggcaccggcctccggcgggaa
tattggatcatcaccgcgttccatgccaggggcaacctgaaggattacttggccggccat
ctcctcaactgggccaccttcctgcgcatgtcgggctccatagtgagtggcgtggcccat
ctgcacagcgactccgccccctgcggcgccgccaaggtccccattgcccaccgggacatc
aaaagcaccaacatcctggtgagaagcgactgccggtgcctcgtgtgcgactttggcatc
gccgtgcggctggaccctgcgctcaccagcgaggacttggccaacagcgggcaggttggc
actgccaggtacatggcaccggaggttttggagtcccgagtgaacttggaagacctggaa
tctttcaaacagatggacgtctattccctgtcactggtactgtgggaactgggcacccgc
tgtgatgcctccggggagacaaggagctatgagctgccttttgggagcaaagtgcgagag
cagccgtgtgtggaaaccatgagggacctggtgttgcacgggcgcgtccggcccgaaatc
cccccctcctggggcagccacccgggactgaatatcctgcgagacacaatcacagagtgc
tgggaccatgaccccgaggcccgtctcactgctcactgtgtggccgaacgctttaaacta
atggcacagacggactgtgatcccagtaaccatcactcgactgactga

DBGET integrated database retrieval system