KEGG   Xenopus tropicalis (western clawed frog): 100492442
Entry
100492442         CDS       T01011                                 

Gene name
golga2
Definition
(RefSeq) golgin subfamily A member 2 isoform X4
  KO
K20358  golgin subfamily A member 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    100492442 (golga2)
Membrane trafficking [BR:xtr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    100492442 (golga2)
SSDB
Motif
Pfam: GOLGA2L5 GM130_C
Other DBs
NCBI-GeneID: 100492442
NCBI-ProteinID: XP_002935553
Xenbase: XB-GENE-1003130
UniProt: A0A5G3IAT6
LinkDB
Position
8
AA seq 970 aa
MADESRQNKLASARRKLKEFQQKATVPAPTGGKKKKKSKESDPDNPARLSPDPENEYDGR
NIQPAENRSLSSTDSLRQLSEQLNGLVSQSNSYVNGENIISASSPELESRFQELAAALDS
SNLTNKQLSTKIEELKQQNQVISDQMEKEKKGFEQKFVKEQGALREQLQVHIQTIGILVS
EKSELQTALSHTQQAARQKAAEAEDLALRLQSTRQRVTELERTLSSISAQQKQVEKLNKE
LEKERDSLRLESLKNSKSNEELKQQNSELSEKLNTLISKNAAMRLEAGDLMKKLEMAELM
IQQFSNQTGAPDTNQQLRMVLEERDLLGAQLTQMSETLQQLTTERDQYLEKLKEEGAIWQ
ERVRLLSEQIQTLGQEKQTAQVQVEQLETRVTELLLASAAEPTDTEPTPPAGPSETELAL
HQEVDQLQQNFSDLQARYQAQVQDNSQLSRLNQEQEERLLELEKTLQRQSEENVDKQQIL
ENMQSDKATISRALTQNRQLKEHLAELQNGFVKLTNENMELTNALQSEQHVKKELAKKLG
QLQETLGDFKEQLAAKEQDIQILQSQRDEVSAHLQQYSAAYQQVSIEKEEIQRQYLLQAQ
LMDRLQHEEVQGKVSAEMHLKELQQSRENLELLTKENQELRAQVLQIRSEPDSRVLNRME
GDGVESEVYEDEILKTSLDIPEDFENREEMVAFISTAIAKVQGEREETERQLAEQKRYCQ
GLLRQISEIRRQQSSGTMHHAADLGMDSIPREVYDALQSAMEKLQLRFTDLMQERVDLKE
RVEELEHRCIQLSGETDTIGEYIALYQSQRAILKQRHKEKEEYISRLAQDKEEMKAKLLE
LQVLVMRLVSERNEWYRRFVEATQGPHIGSPEFPAENLMALEAKENGALEEVSLEEDGEQ
EEVQLLSHLAAPQEGPNPSPESEDPTTKQIMQLLHEIQNPQERPSALLQNPCIPFFYRAD
ENDEVRIMVI
NT seq 2913 nt   +upstreamnt  +downstreamnt
atggcagacgagagcaggcagaacaagctggcgtcggcccggcggaagctaaaggagttt
cagcagaaggcgaccgttccggcgccaacaggaggcaagaaaaagaaaaagtccaaagaa
tctgatcctgataacccagcacggctctctccagacccagaaaatgaatacgatggcagg
aatatacagccagcagagaacaggtctctctcgtcaacagatagcctccggcaactttca
gaacaacttaacggacttgtgtcacagtcaaattcctatgttaatggagaaaatatcatc
tcagcgagcagcccagaactggagtctcgtttccaggagctggctgctgctctggactcc
agcaatctaacaaacaagcaactcagtacaaagatagaggaactgaaacagcaaaatcaa
gtgatttcagatcagatggaaaaggagaaaaagggatttgaacagaagtttgtgaaggag
caaggtgctctaagggaacaactgcaggttcatattcagactattggcatcctggtctca
gaaaaatcggaactgcaaacagccctttctcacacacagcaggctgcacggcaaaaagca
gctgaggctgaggatcttgccctgcgattgcaatctaccagacaaagagtgacagagctg
gaacggactctctcttccatctcagcacagcagaagcaggtggaaaagctgaataaggaa
ctggagaaggaacgtgatagccttcggcttgagtccttaaagaacagtaaaagcaacgag
gagctgaagcagcaaaactctgagctctccgagaaactgaacacacttatttctaagaac
gcagccatgaggttggaggcgggagaccttatgaagaagctggagatggcggagctcatg
attcaacagttctccaatcagacaggagcgccggacacaaatcagcagcttcggatggtt
ttggaagagcgagacctgcttggagcacagttaacacagatgtcggagactcttcagcaa
ctaacaactgaacgtgaccagtacttagagaaactcaaggaagagggggctatctggcag
gaaagagtccgacttctttctgaacagatccagaccttgggccaagagaaacagacagct
caggtacaggtagaacagttggagaccagggtgacagagctcctgctggcatcagctgct
gaaccaacagacactgagcccacaccccctgccggaccctctgaaactgaactggccctc
caccaagaggtggatcagctacagcagaattttagtgatctgcaggcaaggtatcaggcc
caggtgcaagacaacagtcagctgagccggctgaaccaggaacaggaagagcggctactg
gaactggagaagacgttacaacgccagagtgaagaaaacgtagacaagcagcagatcctg
gaaaacatgcagagcgataaagccaccattagccgggcactgacccagaacaggcaactg
aaggaacatttggccgagctccagaatggatttgtcaaactgacaaatgaaaacatggag
ctcaccaatgcattacagagtgagcagcatgtgaaaaaggagctggccaagaagctgggg
caattacaggagaccctgggcgatttcaaagagcagctggctgcaaaggagcaggacata
cagattctgcagagtcagcgagatgaggtctccgctcacctccagcagtacagtgcagca
tatcagcaagtctccattgagaaagaggagatccagaggcagtatctgctgcaggctcag
ctgatggacagattgcagcacgaggaggtgcaggggaaggtcagcgcagagatgcacctc
aaggagttgcaacagagcagagaaaacctggagcttctcactaaagaaaaccaagagctg
agagcgcaagtgctacagatccggagtgagccagacagccgagtgctcaataggatggaa
ggagatggagtggagagtgaagtgtatgaagatgagattctaaagacttcactggacatc
cctgaggactttgaaaacagagaagagatggtagcatttataagcacagccatagcaaag
gtgcaaggggaacgggaagaaacggaaagacagctggcggaacaaaagcggtactgtcaa
ggtctcttgcgtcagatatcggaaataaggcggcagcagtcatctgggaccatgcatcat
gcagcagatctcggtatggacagcattcccagagaggtgtatgatgcattgcaaagtgcc
atggagaagttacagctccggtttaccgacttgatgcaggagagggtagacctgaaggag
cgcgtagaagagctggagcatcgatgcattcagctgtcaggagagacagacactattggt
gaatacattgcactttatcagagccagagagctatactgaagcagcgtcacaaggaaaag
gaggagtacattagccgactggctcaggacaaggaagagatgaaggcgaagctgctggaa
ctgcaagtcctggtcatgaggctggtgtctgagcgcaatgagtggtaccggaggtttgtg
gaagccacccagggtccccacataggctccccagagttccctgcagaaaatcttatggca
cttgaggcaaaagaaaatggagctctggaggaagtcagcttagaagaggatggggaacag
gaggaagtccagttgttgtcacatttggcagcccctcaggaaggaccaaacccgagccct
gaatcagaagacccaaccactaaacaaattatgcaacttctgcatgagatacagaacccg
caggaacggcccagcgccctgctgcaaaatccctgcatcccctttttctaccgtgctgac
gagaacgacgaggtccgaattatggtgatttga

DBGET integrated database retrieval system