KEGG   Xenopus tropicalis (western clawed frog): 100494034
Entry
100494034         CDS       T01011                                 

Gene name
epo
Definition
(RefSeq) erythropoietin precursor
  KO
K05437  erythropoietin
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100494034 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xtr04052]
    100494034 (epo)
Cytokines and growth factors [BR:xtr04052]
 Cytokines
  CSF and other factors
   100494034 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100494034
NCBI-ProteinID: NP_001233194
Xenbase: XB-GENE-12440940
UniProt: G0T3F6
LinkDB
AA seq 183 aa
MGVTGLLTLLSMLFVSVKLVTCAPYKPVCDKTVVDMFIKEAREAETAMDSCNIICQFPED
IMVPETKLNLGEWNKLHVCISIPQAAEVWNGLILFTKAVPRIADFISDASLKFQVEKIHG
DVRSAVHLFKSLNLQDEVQTSQSEAKTLPVRTFKKFFSVYTNFLRGKLRLLVMAVCHEAS
LFT
NT seq 552 nt   +upstreamnt  +downstreamnt
atgggtgtgactggtctacttactctgctatcaatgttgttcgttagtgtgaagctcgtt
acatgcgccccctacaagcctgtctgtgacaaaacagtggtggacatgttcattaaagag
gccagagaagcagaaacagcgatggattcctgcaatattatctgtcaatttcctgaggat
atcatggtccctgaaacaaaactgaacctcggagaatggaataaattacatgtatgtata
tcaattcctcaggcggcagaggtttggaacggtctcatcttatttacaaaagccgtccca
aggattgctgatttcatctcagatgccagcttaaagttccaagtagaaaaaatccacggc
gacgtccgcagcgctgtacatttatttaagagcctcaacttgcaggatgaagttcagaca
tcccagtcagaagcaaagacacttccagtacggacattcaaaaaatttttttctgtttac
actaattttttacgaggtaaattgagactgcttgtgatggcagtgtgccacgaggcaagc
ttatttacgtga

DBGET integrated database retrieval system