KEGG   Xenopus tropicalis (western clawed frog): 100498278
Entry
100498278         CDS       T01011                                 

Gene name
stat3.1
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04068  FoxO signaling pathway
xtr04217  Necroptosis
xtr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100498278 (stat3.1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100498278 (stat3.1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100498278 (stat3.1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xtr03000]
    100498278 (stat3.1)
Transcription factors [BR:xtr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100498278 (stat3.1)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N AP1AR Tropomyosin_1
Other DBs
NCBI-GeneID: 100498278
NCBI-ProteinID: XP_031750540
Xenbase: XB-GENE-481047
LinkDB
Position
10
AA seq 769 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAFAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEEGRLLQTAA
AAAQQGGPASHPTAAVVTEKQQMLEQHLQDVRKKVQDLEQKMKVVENLQDDFDFNYKTLK
SQSDLSELNGSNQSVTRQKMQQLEQMLTALDQLRRTIISDLASLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHQEPTDPGSTAPYLKTKFICVTPTTCS
STLDLPMSPRTLDSLMQFPGEGVESSAGNQFETLTFDMELTSECAASPM
NT seq 2310 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccaattgcagcagctggacacgagatacttggagcagttacaccag
ctctatagtgacagctttccaatggagcttcgccagttccttgccccgtggatcgagagc
caagactgggcatttgcagccagcaaggagtcccatgccacactggtgtttcacaaccta
ctgggggagatagaccagcaatacagccgatttctgcaagaatccaacgtactttatcaa
cacaacctgcggcggattaaacagttcttacagagtagatatttggaaaaacccatggaa
attgcccgaatcgtggcccggtgtctgtgggaagaagggcgacttctccaaactgccgca
gcagctgcacagcaaggaggtccggcctcgcaccccacagcagccgtggttacggaaaag
cagcagatgttggagcaacatttacaagacgtgcggaaaaaagtccaggacctggagcaa
aagatgaaagttgtcgagaaccttcaggatgactttgatttcaactacaaaactttaaaa
agccaaagcgacctttctgagctgaatggcagcaatcagtcagtcacaaggcagaagatg
cagcagctggagcagatgttaactgcgttggatcagttgagaaggaccattattagtgat
ctggccagtctcctgtcagccatggaatatgttcagaagacattgactgacgaagagctc
gctgattggaagaggaggcagcaaattgcctgcattggtgggcccccaaatatttgcctt
gatcggctggaaaactggataacctccctggctgagtcccagctccagacccgacagcag
atcaaaaagctagaggagttacagcaaaaggtttcctacaagggagacccaatagttcag
caccgacccatgctggaggagagaattgtggagttatttagaaacctcatgaaaagtgcc
tttgtagtggagaggcagccgtgtatgccaatgcatcctgaccgcccgctggttattaag
acgggagtacagtttactaccaaagtcaggctgctggtgaagttccccgagctcaattac
caactgaaaattaaagtttgcattgacaaggattcgggcgatgtcgctgcactaagaggt
tcacggaagttcaatatcctcggtacaaacaccaaagttatgaacatggaggaatcaaac
aatgggagcctctctgctgaattcaaacacttgactctgagagagcagcgatgtgggaat
gggggaagagcaaactgtgatgcctcccttatagttacggaagagctgcatctcatcaca
tttgaaactgaagtttatcatcaggggctgaagatcgacctggagactcattccctgcca
gttgtggtgatttccaatatctgtcagatgcccaatgcttgggcttctatcctgtggtac
aacatgctgaccaacaaccccaagaatgtcaactttttcaccaagccccccattggcact
tgggaccaggtggcggaggtgctcagctggcagttttcctcgaccaccaaacggggactg
agtattgagcagctcacgactctggcagagaaactgttgggtcccggagtcaactattcc
ggatgccaaatcacctgggccaagttctgtaaggaaaacatggccggcaaagggttctcc
ttctgggtttggctggacaacatcattgatcttgtgaagaaatatatcctggcactttgg
aatgaagggtatattatgggcttcatcagcaaagagcgtgagcgagccattctgagtacc
aagcccccgggaacgttcctgctgaggttcagtgaaagcagcaaggagggaggcatcacc
ttcacctgggtagagaaagacatcagtggtaagactcagattcagtcagtggaaccctac
accaagcaacagctaaacaacatgtcatttgctgagattattatgggatataaaatcatg
gacgctaccaatatcctggtgtcccctttggtttacctgtaccccgatatccctaaagag
gaagccttcggaaagtactgccgcccagagagccaggagcatcaggagcccactgaccca
ggtagcacggccccatatctaaagaccaagtttatctgcgttaccccgacaacgtgtagc
agtacattagatttgccaatgtctcctcggactttggattctttgatgcagtttccaggg
gaaggggtggaatccagcgctggaaatcagtttgagaccctaacgttcgatatggagctt
acgtccgaatgcgcagcttctcccatgtga

DBGET integrated database retrieval system