KEGG   Xenopus tropicalis (western clawed frog): 548862
Entry
548862            CDS       T01011                                 

Gene name
ccndx
Definition
(RefSeq) cyclin Dx
  KO
K04503  G1/S-specific cyclin-D1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04068  FoxO signaling pathway
xtr04110  Cell cycle
xtr04115  p53 signaling pathway
xtr04218  Cellular senescence
xtr04310  Wnt signaling pathway
xtr04340  Hedgehog signaling pathway
xtr04371  Apelin signaling pathway
xtr04510  Focal adhesion
xtr04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    548862 (ccndx)
   04340 Hedgehog signaling pathway
    548862 (ccndx)
   04371 Apelin signaling pathway
    548862 (ccndx)
   04068 FoxO signaling pathway
    548862 (ccndx)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    548862 (ccndx)
   04115 p53 signaling pathway
    548862 (ccndx)
   04218 Cellular senescence
    548862 (ccndx)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    548862 (ccndx)
   04530 Tight junction
    548862 (ccndx)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 548862
NCBI-ProteinID: NP_001016108
Xenbase: XB-GENE-483042
UniProt: Q28F81
LinkDB
Position
7
AA seq 290 aa
MEGRLLCCESVTELRARADPVLMQSRVLMKLLALEERYIPSASYFRCVQRDIQPYMRHML
TCWMLEVCEDQKCGEEVFPLAVNCLDRYLSLVPVEKRHLQLLGATCLFLASKLRESKPMT
AESLCMYSDHCFTDKELLAMELLVLNKLKWDLEVVTPREYLPHFLELLNIPAEKRPQVRK
HSETFIALCTTDCTFIALPPSMVAAASVAAAVTGLQLQSPGPSYSSLASINLLAHAIHCD
PSLLRACQEQIEISLESSVQRAQRNRVSESKSVDEPERSSTPTDVQDIDL
NT seq 873 nt   +upstreamnt  +downstreamnt
atggagggaaggctgttatgctgtgagtcagtgacagagctgagggcccgggcggaccca
gtgctgatgcagagccgggtgctgatgaagctgttggcgctagaggagcgctacatcccg
tctgcctcatacttccgctgtgtgcagcgcgatatccagccctacatgcgtcacatgctc
acctgctggatgctggaggtgtgtgaagaccagaagtgcggagaagaggtgtttcccctg
gctgtgaactgcctggaccggtacttgtccctggtgccagtagagaagagacaccttcag
cttctgggcgcgacgtgcctctttcttgcctccaaactgagggaatcaaagcccatgact
gccgagagtctctgcatgtactcagaccactgtttcactgacaaagaactgctggcaatg
gagctgttggtgctgaacaagctgaagtgggacttagaagtggtgacaccccgcgagtac
ctaccgcacttcctggaactgctaaatatccccgcagagaagaggcctcaggtcaggaag
cacagcgagaccttcatcgctctgtgcaccacagactgtacattcattgcactaccccct
tccatggtggctgcagccagtgtagccgcagcagtgaccggcctccagcttcagagtcca
ggaccgagctattccagcctggcatccataaacctgcttgcccacgccatccactgtgac
ccgagtcttctcagagcgtgccaggagcagattgagatctcactggaatccagtgtgcag
cgggcacagagaaacagggtctctgagtccaaatctgtggatgagcccgagagatccagc
accccgaccgacgtgcaggacatagacctataa

DBGET integrated database retrieval system