KEGG   Xanthomonas vasicola: C7V42_10200Help
Entry
C7V42_10200       CDS       T05388                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xva  Xanthomonas vasicola
Pathway
xva00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xva00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C7V42_10200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xva02000]
    C7V42_10200
Enzymes [BR:xva01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     C7V42_10200
Transporters [BR:xva02000]
 Other Transporters
  Pores ion channels [TC:1]
   C7V42_10200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AVQ06926
UniProt: A0A315FAV1
LinkDB All DBs
Position
2220738..2221436
Genome map
AA seq 232 aa AA seqDB search
MITVHHLNNSRSQRVLWLLEELALPYQIVRHERDPKTMLAPPALRAIHSLGKSPLLVDGD
LVVAESGAILEYLTERYDTECALSPSPRPLDSPERLQFRYWMHYAEGSAMPPLLMTLILG
RIRSAPMPFFARPIARAIVDKAMSGFVGPQLSLHLDWMEQSLQSGNWFAGERFTAADIQM
SFPVQAAAARGGGLEKYPRLRGFLERIEARPAYQAALKKGGPFELMGSKPAT
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgttcaccatctcaacaactcccgttcccagcgcgtgctgtggctgctggaa
gaactggcgctgccgtatcagatcgtgcgccacgagcgcgaccctaagaccatgctggca
cccccggctttgcgtgcgatccattcgctgggtaaatcgcctttgctggtcgatggcgat
ctggtggtggccgaatccggtgcgatcctggagtacttaaccgagcgctacgacaccgag
tgcgcgctgtcgccgtcgccgcggccgctggattcgcccgagcgtctgcagttccgctat
tggatgcattacgccgaaggctcggcgatgccgccgttgctgatgacgttgatcctcggt
cgcatccgcagtgcgccgatgccgttcttcgccaggcctatcgcgcgtgcgatcgtggac
aaggcgatgtctggcttcgttgggccgcagctttcattgcatctggactggatggagcag
tcgttgcagtccggcaactggttcgctggtgaacgctttactgccgccgacattcagatg
agtttccccgtgcaggcggcggccgcgcgtggcggcggactggagaaatatccgcgtctg
cgcgggtttttggaacgcatcgaagcacgtcctgcctatcaggctgcgctgaagaaaggt
ggcccgttcgagttgatgggaagcaagccagcaacgtga

DBGET integrated database retrieval system