KEGG   Yersinia enterocolitica FORC_002: FORC2_0037Help
Entry
FORC2_0037        CDS       T03890                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
yef  Yersinia enterocolitica FORC_002
Brite
Enzymes [BR:yef01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     FORC2_0037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N HTH_54
Motif
Other DBs
NCBI-ProteinID: AKF36184
UniProt: A9U908
LinkDB All DBs
Position
complement(43862..44485)
Genome map
AA seq 207 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEDLIKD
LDKVPAEKRTFMRNNAGGHANHSLFWKGLKLGTTLTGDLKAAIERDFGSVDSFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGASGFPIVGLDVWEHAYYLKFQ
NRRPDYIKAFWNVVNWDEAAARFAQAK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttactcactgccatccctgccttatgcttatgacgccctggaaccacacttcgat
aagcagacgatggaaatccatcacaccaaacaccaccaaacctatgttaacaatgcaaac
acggtgttggagagcttccctgagctggctaaattcagtgttgaagatctgatcaaagat
ctggacaaagttccagctgaaaaacgcacctttatgcgtaataacgccggcggtcacgct
aaccacagcctgttctggaaaggcctgaaactgggcaccactctgaccggtgacctgaaa
gccgctatcgaacgcgacttcggcagcgttgacagcttcaaagaaaaatttgaacaagct
gcggcaacgcgtttcggttcaggctgggcctggctggtactgaaagacgacggcaaactg
gctgttgtttcgactgctaaccaagacagcccgctgatgggtgaagctgtttctggcgca
tcaggtttcccgattgtgggcctggatgtgtgggaacacgcttactacctgaaattccaa
aaccgccgcccagactacatcaaagcattctggaacgtggttaactgggacgaagcagcc
gcgcgtttcgctcaagctaagtaa

DBGET integrated database retrieval system