KEGG   Yersinia enterocolitica FORC_002: FORC2_3879Help
Entry
FORC2_3879        CDS       T03890                                 

Definition
(GenBank) 16S rRNA methyltransferase
  KO
K08316  16S rRNA (guanine966-N2)-methyltransferase [EC:2.1.1.171]
Organism
yef  Yersinia enterocolitica FORC_002
Brite
KEGG Orthology (KO) [BR:yef00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:yef03009]
    FORC2_3879
Enzymes [BR:yef01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.171  16S rRNA (guanine966-N2)-methyltransferase
     FORC2_3879
Ribosome biogenesis [BR:yef03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    FORC2_3879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cons_hypoth95 MTS RrnaAD
Motif
Other DBs
NCBI-ProteinID: AKF40026
LinkDB All DBs
Position
4427825..4428508
Genome map
AA seq 227 aa AA seqDB search
MAKRPLAKRSTTERSITTAKQAPQQSAGQIRIIGGKWRGRKLPVPVSPGLRPTTDRVRET
LFNWLAPMIQGARCLDCFAGSGALGLEALSRYAGFTVLLEADRHVAKQLSNNLTLLSADN
GQVVNTNSLQWLAQPGQPFDLVFLDPPFRKGLLAETVNLLEQFNWLTADAWIYVEAEAES
AAADVPASWQLHREKIAGQVAYRLYIRNNDVPQDRVSVEEQEQHHVD
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcgacctttagcaaagcgatctacaaccgagcgatctataacaacggcaaaa
caagcgccacaacagtcggcaggccaaatccgcatcatcggcggtaaatggcgtgggcgc
aaattaccggtgccggttagccctgggctacgccctaccaccgaccgtgtcagagaaacc
ctattcaactggctcgcccccatgattcaaggtgcccgatgcctggattgctttgcgggc
agcggtgccttagggctggaggcactatcccgctatgccggttttaccgttctgttagaa
gctgacaggcatgtcgctaagcaattgagcaataacctgacgttattgagtgccgacaat
ggccaagtggtcaataccaactctttacaatggttagcccagccagggcagccttttgat
ctggttttccttgatcccccttttcgtaaaggtttgctggcggaaacagtcaatttatta
gagcaattcaactggttgacagctgatgcctggatttatgttgaggcagaggccgaaagt
gccgccgcagatgtccctgccagttggcagttacatcgagagaaaattgccggacaggtt
gcctaccgcctctatattcgtaacaacgatgttccccaagaccgggtatcagttgaagaa
caggagcaacatcatgtggattaa

DBGET integrated database retrieval system