KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE4138Help
Entry
YE4138            CDS       T00469                                 

Gene name
sodA
Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
Brite
Enzymes [BR:yen01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YE4138 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N HTH_54
Motif
Other DBs
NCBI-GeneID: 4716532
NCBI-ProteinID: YP_001008274
UniProt: A1JT34
LinkDB All DBs
Position
4530100..4530723
Genome map
AA seq 207 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEDLIKD
LDKVPAEKRTFMRNNAGGHANHSLFWKGLKLGTTLTGDLKAAIERDFGSIDSFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGASGFPIVGLDVWEHAYYLKFQ
NRRPDYIKAFWNVVNWDEAAARFAQAK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttactcactgccatccctgccttatgcttatgacgccctggaaccacacttcgat
aagcagacgatggaaatccatcacaccaaacaccaccaaacctatgttaacaatgcaaac
acggtgttggagagcttccctgaactggctaaattcagtgttgaagatctgatcaaagat
ctggacaaagttccagctgaaaaacgcacctttatgcgtaataacgccggcggtcacgct
aaccacagcctgttctggaagggcttgaaactgggcaccactctgaccggtgacctgaaa
gccgctatcgagcgcgacttcggcagcattgacagcttcaaagaaaaatttgaacaagct
gcggcaacgcgtttcggttcaggctgggcctggctggtactgaaagacgacggcaaactg
gctgttgtttcgactgctaaccaagacagcccgctgatgggtgaagctgtttctggcgca
tcaggtttcccaattgtgggcctggatgtgtgggaacacgcttactatctgaaattccaa
aaccgccgcccagactacatcaaagcattctggaacgtggttaactgggacgaagcagcc
gcgcgcttcgctcaagctaagtaa

DBGET integrated database retrieval system