KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype O 9): YE105_C3865Help
Entry
YE105_C3865       CDS       T01480                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype:O:9)
Brite
Enzymes [BR:yep01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YE105_C3865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N HTH_54
Motif
Other DBs
NCBI-ProteinID: ADZ44359
LinkDB All DBs
Position
4463475..4464098
Genome map
AA seq 207 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEDLIKD
LDKVPAEKRTFMRNNAGGHANHSLFWKGLKLGTTLTGDLKAAIERDFGSVDSFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGASGFPIVGLDVWEHAYYLKFQ
NRRPDYIKAFWNVVNWDEAAARFAQAK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttactcactgccatccctgccttatgcttatgacgccctggaaccacacttcgat
aagcagacgatggaaatccatcacaccaaacaccaccaaacctatgttaacaatgcaaac
acggtgttggagagcttccctgagctggctaaattcagtgttgaagatctaatcaaagat
ctggacaaagttccagctgaaaaacgcacctttatgcgtaataacgctggcggtcacgct
aaccacagcctgttctggaagggcttgaaactgggcaccactctgaccggtgacctgaaa
gccgctattgagcgcgacttcggcagcgttgacagcttcaaagaaaaatttgaacaagct
gcggcaacgcgtttcggttcaggctgggcctggctggtactgaaagacgacggcaaactg
gctgttgtttcgactgctaaccaagacagcccgctgatgggtgaagctgtttctggcgca
tcaggtttcccgattgtgggcctggatgtgtgggaacacgcttactacctgaaattccaa
aaccgtcgcccagactacatcaaagcattctggaacgtggttaactgggacgaagcagcc
gcgcgcttcgctcaagctaagtaa

DBGET integrated database retrieval system