KEGG   Yangia pacifica: CEW88_05075Help
Entry
CEW88_05075       CDS       T05431                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ypac  Yangia pacifica
Pathway
ypac00473  D-Alanine metabolism
ypac00550  Peptidoglycan biosynthesis
ypac01100  Metabolic pathways
ypac01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ypac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CEW88_05075
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CEW88_05075
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CEW88_05075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ypac01011]
    CEW88_05075
Enzymes [BR:ypac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CEW88_05075
Peptidoglycan biosynthesis and degradation proteins [BR:ypac01011]
 Precursor biosynthesis
  Amino acid ligase
   CEW88_05075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N B12-binding ATPgrasp_ST ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AWI83089
UniProt: A0A2U8HAU8
LinkDB All DBs
Position
1:1043959..1044849
Genome map
AA seq 296 aa AA seqDB search
MAVLMGGPSAEREVSLSSGRECAAALRNEGFEVIDLDAGPDLAARLVDLSPDVVFNALHG
RWGEDGCVQGLLEWMRIPYTHSGVLASAVAMDKERSKQVYRDVGLPVVDSLLASKAEVAA
SHLLPPPYVVKPYNEGSSVGVYLVMDGANQPPQLSEEMPETVMVETYAPGRELTTTVLGD
RALTVTDIITEGWYDYDAKYKAGGSRHVVPAEIPQQIFDACLDYALRAHKALGCRGLSRT
DFRWDESRGLDGLVLLETNTQPGMTPTSLAPEQAQACGMTFGALCRWMVEDASCDR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtattgatgggcggaccttcggctgagcgcgaggtctcgctgagttccggtcgg
gaatgtgccgccgctttgcggaatgagggatttgaggtgatcgacctagacgcggggccc
gacttggccgcgcggcttgtggacctgtctcccgacgtcgttttcaacgcacttcatggc
cgctggggcgaggatggctgcgtgcagggcctgctcgagtggatgcggatcccctacacc
cattccggcgtgctggcctcggccgtggcgatggacaaggaacgctccaagcaggtctac
cgcgacgtgggtctgccggtggtcgacagcctgctggcctccaaggccgaggttgccgcc
agccacctgttgccgcccccctatgtggtgaagccctacaacgagggcagctcggtcggc
gtctaccttgtgatggatggcgccaatcagccgccgcagctctccgaggagatgcccgag
acggtgatggtcgagacctatgcgccgggccgcgagctgaccactacggtgctcggcgac
cgcgcgctgacggtgaccgacatcatcaccgagggctggtacgactacgacgccaagtac
aaggccggcggctcacgccacgtggtgcccgccgagatcccgcagcagatcttcgatgcc
tgcctcgattacgcgctgcgcgctcacaaggcgcttggctgccgcggcctcagccggacc
gatttccgttgggacgagagtcgcggtctggatgggctggtgctgctcgagacgaacacc
cagccgggcatgacgcccacctcgctggcccctgagcaggcgcaggcctgcggcatgacc
ttcggcgcgctctgccgctggatggtggaggacgcctcatgcgacaggtag

DBGET integrated database retrieval system