KEGG   Yersinia pseudotuberculosis PA3606: BZ19_3097
Entry
BZ19_3097         CDS       T03846                                 

Definition
(GenBank) hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
ypf  Yersinia pseudotuberculosis PA3606
Brite
KEGG Orthology (KO) [BR:ypf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypf02044]
    BZ19_3097
Secretion system [BR:ypf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BZ19_3097
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N MafB
Other DBs
NCBI-ProteinID: AJK15380
LinkDB
Position
complement(3542480..3543868)
AA seq 462 aa
MDITSQHPWHVLLQAPLSPEQTAQALADDDPQWEYIDGQMVKLGSLAHATLNIDDIQQQA
MALLSQKSKDFRLVVHLLRTLQHGGQPDELMLAMSLLTEYVQLFWTTAWPQNPLHKRRFA
QQILKRFDSASSSFSQRADEAQRENVQGLLAHLAQVWHSREPGLAKEVDALRSRYARPPE
RVIEAVASDEPLSSNTLAAAMAATPVSPSLAIDNTSDRAWRQTLLKMADLLSEQQPDAAI
GFRLRRHAVWGALTAPPMAQSDGRTPLAAVSADRTADYLARLANADLPLWHQVEQSLTLA
PYWLDGHVLSAQIALQLGYDAVAQAIRDELSVFLARIPALKTLFFTDMTPFLSSESAAWL
QQDANHQGRSRTIEQDEIWQCYQQQGLEAALQMINRQPQQSEPRDRFYHQLLSAQLFEKA
GLTALAQQHYHSLLLVGQQLQLSEWEPALIALLTEKQRQLKP
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggatatcacgtcacaacatccctggcatgtcttgttacaagcccctttgtcacctgag
cagaccgcacaagccctggccgatgatgacccccaatgggaatatatcgacggccagatg
gtgaaactggggtcattggcccacgccacgctgaatattgatgatattcagcaacaagcc
atggcgctgttatcacagaaaagtaaagacttccggctcgtggtgcatctactgcgcacc
ctacaacacgggggccagccagatgaattaatgctggcgatgtcgttgctgaccgaatac
gtccagctattttggactacggcctggccgcaaaatcctttacacaaacggcgctttgct
caacaaatcctaaaacgctttgacagcgccagcagcagttttagccaacgagcggacgag
gctcaacgtgagaatgtgcaaggattattggcacatttagcacaggtttggcatagccgt
gagccgggtctggctaaagaggtggatgcattacgcagccgctatgcgcggccaccggag
cgggttatcgaggcagtggcttctgatgaaccgctctcatccaacaccttggcggcggca
atggccgccacccccgttagcccaagcctcgccatagataacacgagcgacagagcctgg
cggcagaccttgctgaaaatggcggatttactcagcgaacagcaacccgatgccgctatc
ggtttccggttacgccgccatgccgtatggggcgcgttaaccgcgccacctatggcgcag
agcgatggccgcaccccgttggccgcagtttctgcggatcgaaccgccgattacttagca
cgtctggctaatgccgatttgcctttgtggcaccaagtggagcagagcctcaccctcgcg
ccttattggctggatgggcatgtgctttcggcacaaatcgccctgcaactgggttatgac
gcggtggcacaggctatccgtgatgaactcagcgtttttttagcccgtattcccgcatta
aaaaccctcttttttacggatatgacgccattcctctcctctgaatctgccgcctggtta
cagcaggatgcgaatcatcagggaagaagtcgcactattgaacaggatgaaatttggcaa
tgctatcaacagcaaggattggaagccgcactacagatgataaaccggcaaccacagcaa
tccgaacctcgggaccgtttttaccatcaattgctcagtgcacagttgttcgaaaaagca
gggttaaccgcattggcgcagcagcactaccacagcttattactggtggggcagcaatta
cagctaagcgaatgggaacctgcgttgatcgctctactgacagaaaaacagcgacaactc
aaaccatga

DBGET integrated database retrieval system