KEGG   Yersinia pseudotuberculosis ATCC 6904: DJ40_2842Help
Entry
DJ40_2842         CDS       T03307                                 

Gene name
accC
Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
ypq  Yersinia pseudotuberculosis ATCC 6904
Pathway
ypq00061  Fatty acid biosynthesis
ypq00620  Pyruvate metabolism
ypq00640  Propanoate metabolism
ypq01100  Metabolic pathways
ypq01110  Biosynthesis of secondary metabolites
ypq01120  Microbial metabolism in diverse environments
ypq01130  Biosynthesis of antibiotics
ypq01200  Carbon metabolism
ypq01212  Fatty acid metabolism
Module
ypq_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ypq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DJ40_2842 (accC)
   00640 Propanoate metabolism
    DJ40_2842 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DJ40_2842 (accC)
Enzymes [BR:ypq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     DJ40_2842 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     DJ40_2842 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp_3 ATP-grasp Dala_Dala_lig_C RimK ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AIN15700
LinkDB All DBs
Position
complement(3160595..3161944)
Genome map
AA seq 449 aa AA seqDB search
MLDKIVIANRGEIALRILRACKELGIKTVAVHSVADRDLKHVLLADETVCIGPAPSVKSY
LNIPAIISAAEITGAVAIHPGYGFLSENADFAEQVERSGFIFIGPRAETIRLMGDKVSAI
SAMKKAGVPCVPGSDGPLSDDTTKNKAFAKRIGYPVIIKASGGGGGRGMRVVRHDKDLEE
SINMTRAEAKAAFNNDMVYMEKYLENPRHIEVQILADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITSEMRRYIGERCAKACMEIGYRGAGTFEFLYENGEFYFIEMNTRIQVEHTVT
EMITGIDLIKEQLRIAAGQPLSIKQDEVKVHGHAVECRINAEDPNTFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLITYGENRDVAIARMKNALAELIIDGIKTNVEL
QQRIMNDENFQHGGTNIHYLEKKLGLQET
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataaaatcgtaatcgctaaccgcggtgagattgcgctgcggatcctacgggct
tgtaaggagctggggatcaagactgtcgccgttcactctgttgcggatcgtgacctgaaa
cacgtattactggctgacgagactgtttgtatcggtcctgcgccttcagttaaaagctat
ctgaacatcccggcaatcatttcggctgctgagatcaccggcgcagtggctattcacccc
ggctatggtttcctgtctgaaaatgctgattttgccgaacaggtagagcgttccggtttc
attttcattggcccacgagctgaaaccattcgtctgatgggcgataaagtttccgctatt
agcgcaatgaaaaaagccggtgtgccatgcgtacccggttctgatggcccattaagcgac
gataccaccaagaacaaagcctttgccaaacgtatcggttatccggtcattatcaaggca
tctggcggcggcggtggccgtggtatgcgtgtggttcgtcacgacaaagatctggaagaa
tccattaacatgacccgtgcggaagcgaaagctgctttcaataacgacatggtttatatg
gagaaataccttgagaacccgcgccatatcgaggttcagattttggctgatggtcagggt
aatgctatctatctggccgaacgcgattgctctatgcagcgccgccaccagaaagtggtt
gaagaagcacctgcaccaggtatcaccagcgaaatgcgccgttatatcggtgagcgctgc
gcgaaagcctgtatggaaatcggttatcgcggtgcaggtacctttgagttcttgtatgaa
aacggtgagttctatttcattgaaatgaacacccgtattcaagttgaacacacggttacc
gaaatgatcaccggtattgatttgatcaaagagcagctccgtatcgcggctggccaacct
ctctccatcaaacaagatgaagtgaaagtgcatggccacgctgttgaatgccgtattaac
gccgaagatccaaataccttcctgccaagtccgggtaaaattacccgcttccatgcaccg
ggcggtttcggtgttcgttgggaatctcatatttacgcaggctatactgtgcctccgtat
tatgattccatgattggtaagctgatcacttacggtgaaaaccgtgacgtggcgattgct
cgtatgaaaaatgccttggcagagctcattatcgatggcatcaaaaccaacgttgagtta
cagcaacgcattatgaatgacgaaaacttccagcacggtgggactaatatccactatctg
gagaaaaaactcgggttgcaagaaacctga

DBGET integrated database retrieval system