KEGG   Yersinia pestis PBM19: CH59_2016Help
Entry
CH59_2016         CDS       T03716                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ypw  Yersinia pestis PBM19
Brite
Enzymes [BR:ypw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CH59_2016 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AJI91221
UniProt: A0A384LEC1 A0A380PI18
LinkDB All DBs
Position
2308096..2308719
Genome map
AA seq 207 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELADLSVEDLIKD
LDKVPAEKRTFMRNNAGGHANHSLFWKGLKLGTTLAGDLKAAIERDFGSVDSFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGVSGFPIVGLDVWEHAYYLKFQ
NRRPDYIKAFWNVVNWDEAAARFAQAK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatcactgccttatgcttatgatgccttagaaccacacttcgat
aagcagacgatggaaatccatcacaccaaacaccatcagacctatgttaacaatgcaaat
acggtgttggagagcttcccggagctggcggacctgagcgttgaagatctgatcaaagat
ctggataaagtccctgctgaaaagcgcacctttatgcgtaacaacgcaggcggccacgct
aaccacagtctgttctggaaaggcctgaaactgggcaccaccctagccggtgacctgaaa
gccgctatcgagcgcgatttcggcagcgtagacagcttcaaagaaaaatttgaacaagct
gctgcgacccgtttcggttctggctgggcttggctggtactgaaagacgacggcaaactg
gcggttgtttcaaccgctaaccaagacagcccgctgatgggcgaagccgtttctggcgta
tcaggtttcccgattgtgggcctggacgtatgggaacacgcttactacctgaaattccaa
aaccgccgcccagactacatcaaagccttctggaacgtggttaactgggatgaagctgca
gcgcgtttcgctcaagccaagtaa

DBGET integrated database retrieval system