KEGG   Ziziphus jujuba (Chinese jujube): 107411427Help
Entry
107411427         CDS       T04794                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju03030  DNA replication
zju03410  Base excision repair
zju03420  Nucleotide excision repair
zju03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:zju00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107411427
   03410 Base excision repair
    107411427
   03420 Nucleotide excision repair
    107411427
   03430 Mismatch repair
    107411427
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:zju03032]
    107411427
   03400 DNA repair and recombination proteins [BR:zju03400]
    107411427
Enzymes [BR:zju01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107411427
    6.5.1.6  DNA ligase (ATP or NAD+)
     107411427
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107411427
DNA replication proteins [BR:zju03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107411427
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107411427
DNA repair and recombination proteins [BR:zju03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107411427
   NER (nucleotide excision repair)
    Other NER factors
     107411427
   MMR (mismatch excision repair)
    Other MMR factors
     107411427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 107411427
NCBI-ProteinID: XP_015874494
LinkDB All DBs
Position
2
AA seq 855 aa AA seqDB search
MLKLRSCYSLRYVPISLPLFKSTSSFSLIFPSNPFSLTLTLTPFTLSLNPNPTSSYMSSR
PSAFDALMSGARAAAGKKTQPSSPKKRKAVDSNPTPKPDSTPSENPKSKTTHLLSGTTDT
SEAAKKKTRSSSPTRRKSPNSKPSPTHDSSPSEKATQFLSGTTDNSESNGNGAQQNGHGV
GTSNSAATPEASSIAKKASLAINVKERVSELKSKTDQLKKKAGDFDPKLVACWNQGEKVP
FLFLALAFDLIANETGRIVITDIVCNMLRTVMYTTPEDLVPVLYLSANRIAPAHEGLELG
IGDASIIKALAEACGSSEAKVKKQYKDLGDLGLVAKASRSSQSMMRKPDPLTVSKVFNTF
RIIAKESGKDSQEKKKNHIKALLVAATDCEPQYLIRLLQAKLRIGLAEQTLLAALGQAAV
YTEKHSTPPPNIQSPLEEAVKIVKQVYSVLPVYDKVVPALLSNGIWDLQKTCSFTPGVPV
GPMLAKPTKGVSEIVQKFQDTEYTCEYKYDGERAQIHYLENGSVEIYSRNAERNTGKFPD
VVAAVSRLKKSSVSSFVLDCELVAYDREKQKILPFQILSTRARKNVVMGEIKVDVCIYAF
DMLYHNGRPLIQEELKVRRECLYESFEEEAGYFQFATAITSNDIDEIQKFLDAAVDASCE
GLIIKTLNKDSTYEPSKRSLNWLKLKKDYMDSIGDSLDLVPIAAFHGRGKRTGVYGAFLL
ACYDSNNEEFQSICKIGTGFSEAVLEERSASLRSKVIPKPKAYYRCAETITPDVWFEPTE
VWEVKAADLTISPVHRAAVGIVDPDKGISLRFPRLLRVREDKTPEQASSSEQVADMYAAQ
SHNQSKNQDDNEDID
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacttcgttcatgctattccctgcgctacgttccaatatctctcccccttttc
aaatccacctcttctttctctctcatcttcccctccaacccattttctctcactctcact
ctcacacccttcaccctctccctaaaccctaaccctacctcctcctacatgtcttctcgc
ccctccgctttcgacgctctcatgtccggcgctcgagccgccgccgggaagaaaacccag
ccctcttcccctaagaaacggaaagctgtcgactccaaccccactccaaaacccgattcc
acgccttccgagaatccgaagtcgaagacgacccacttgctctccggtacgaccgacacc
tctgaagctgccaagaagaaaacacggtcttcttcccccacaagacggaaatcccccaac
tctaaaccctcgccaacccacgattcctcgccttcggagaaggctacccagttcctctcc
gggacgacggacaactcagagtctaacggaaatggagcgcaacagaatggtcatggcgtc
gggacttcgaattcggctgcgactccggaggcctcttcgatagccaagaaagcttccttg
gccataaacgttaaggagagggtctccgaattgaagagcaaaaccgatcaattgaagaag
aaggctggggatttcgaccccaaattggtcgcgtgttggaaccagggcgagaaggtgcca
tttctgttcctcgctttggctttcgatttgattgccaacgagacgggacggattgtgatt
actgatatagtgtgtaacatgctgaggactgtgatgtacaccacacctgaggatttagtg
ccggtgctttatctttcggccaatcggattgcaccagcacacgaagggttggagcttgga
attggggatgcttcaattattaaggcgcttgctgaagcttgtggcagttctgaagcgaag
gttaaaaagcagtacaaggatctgggagatttgggtcttgttgcaaaagcaagtcgttca
tcccaatctatgatgcgcaagcctgatccattaactgtttccaaggtttttaatacattt
cgcatcattgccaaggaatctgggaaggatagtcaagagaagaaaaagaaccatatcaag
gcacttcttgttgcggccactgattgtgaaccccaatatttgatccgtttgcttcaggca
aagttgcgaattggattggcagagcagactctgttagctgctttgggacaagctgcagta
tatactgaaaagcattctactccccctccaaatattcagtctcctttagaagaggctgta
aagattgttaaacaagtgtactccgtgcttccagtatatgataaagttgttcctgccctt
ctgagtaatggtatatgggatcttcagaagacttgtagctttactccaggtgtccctgtt
ggacctatgctagcaaagccaactaagggggtatctgagattgtacaaaaattccaggac
acagaatatacctgtgaatacaaatatgatggagaacgtgctcagatacattatttggag
aatggttcagttgagatatatagtagaaatgctgaacgaaatactggaaagtttcctgat
gttgttgctgcagtttcaaggttaaagaagtcatctgtaagctcatttgttttggattgt
gaactggttgcttatgaccgtgaaaaacagaaaattctgccctttcagatactcagtact
cgagctcggaaaaatgtggtcatgggtgagatcaaggttgatgtttgcatatacgcattt
gatatgttgtatcataatggtcgaccacttattcaggaagaactcaaagttcgtagagag
tgtctttatgagtcttttgaggaagaagctggatattttcagtttgctacagcaataaca
tcgaatgatattgatgaaatacagaagtttcttgatgctgctgttgatgcaagttgtgag
ggtttgattatcaagactttgaataaagattctacatatgagccttccaagcggtcactg
aactggctgaaattgaagaaagactacatggatagtattggggattcactggatttggta
cctattgcagctttccatggccggggaaaacgtacaggtgtctatggtgcttttcttctt
gcttgttatgacagcaataacgaagagtttcaaagcatttgtaaaataggcactggattt
tctgaagcagtgcttgaagaacgttctgctagccttcgctctaaagtgattcctaaacca
aaggcatactatcggtgtgcagagaccattactccagatgtgtggtttgaacccactgag
gtttgggaggtgaaagctgcagacttgactattagccctgttcatcgcgctgcagttggc
atagtagatcctgataagggtatttcccttcgattcccacgtcttcttcgtgttcgggaa
gacaagactccagagcaagcatcatcgtctgaacaggttgctgatatgtatgctgctcaa
agtcacaaccaatccaaaaatcaagatgacaacgaagatattgattga

DBGET integrated database retrieval system