KEGG   Zea mays (maize): 100272575Help
Entry
100272575         CDS       T01088                                 

Gene name
pco087467a
Definition
(RefSeq) uncharacterized protein LOC100272575 precursor
  KO
K01674  carbonic anhydrase [EC:4.2.1.1]
Organism
zma  Zea mays (maize)
Pathway
zma00910  Nitrogen metabolism
zma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    100272575 (pco087467a)
Enzymes [BR:zma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     100272575 (pco087467a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 100272575
NCBI-ProteinID: NP_001140512
UniProt: B4FPD6 A0A3L6FVH0
LinkDB All DBs
Position
2
AA seq 279 aa AA seqDB search
MVSSARALIGLLVAAASLAVALSDGGGMAAPVYGYAAGSPNGPENWGKLSPAYKLCGEGK
QQSPIDIVTKQAVPAATLDTLNRTYGATNATLINDGHDITLALEGKVGTVTVNGKAYSFE
KLHWHSPSDHTINGQRFPLELHLVHRSADGALAVIGILYQLGAPDSFYYQLKRQLGEMAQ
DRCDFAEEEESRVEAGLIHLRSLQKRTGSYFRYTGSLTVPPCTENVVWSVLGKVRQISQD
QLQLLKAPLPGSDARPTQPLNGRTVQFYNPPNSTISFQI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcctccgcccgtgcgctcatcggcctcctcgtcgccgcggcctccctcgccgtc
gcgctctcggatggcggcgggatggcggcgccggtgtacgggtacgcggcggggagcccc
aacgggccggagaactgggggaagctgagccccgcgtacaagctgtgcggggaggggaag
cagcagtcgccgatcgacatcgtcaccaagcaggccgtccccgccgccaccctcgacacc
ctcaaccgcacctacggcgccaccaacgccacgctcatcaacgacggccacgacatcacg
ctggcgctcgagggcaaggttgggacggtgacggtgaacggcaaggcgtacagcttcgag
aagctgcactggcactcgccctccgaccacaccatcaacggccagaggttcccgctggag
ctgcacctggtccacaggagcgccgacggcgcgctggcggtcatcgggatcctctaccag
ctgggcgccccggactccttctactaccagctgaagcggcagctgggcgagatggcccag
gaccggtgcgacttcgccgaggaggaggagtcgcgggtggaggccggcctcatccacctg
cgctcgctgcagaagcgcaccggcagctacttccgctacacgggctccctcaccgtgccg
ccatgcaccgagaacgtcgtctggagcgtcctcggcaaggtgcgccagatcagccaggac
cagctgcagctgctcaaggcgccgctgcccgggagcgacgcgcgccccacgcagccgctc
aacggcaggaccgtccagttctacaacccgcccaacagcaccatctccttccagatctaa

DBGET integrated database retrieval system