KEGG   Zootermopsis nevadensis: 110831166Help
Entry
110831166         CDS       T05136                                 

Definition
(RefSeq) alpha-amylase 2-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00500  Starch and sucrose metabolism
zne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110831166
Enzymes [BR:zne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     110831166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 110831166
NCBI-ProteinID: XP_021922548
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MKSLVCVWLLVLVVVVHSQKDPNVWANRSAIVHLFEWKFNDIADECERFLAPNGYAGVQV
SPVQENVIVSSPNRPWWERYQPISYKIVTRSGDEAAFRSMVRRCNDVGVRIYVDIVINHM
TGDHATAVGVGGSTADTYNLQYPAVPFGPNDFNQPQCGIDNYEDPNNVRNCELVGLHDLN
QGSGYVREKIIGFLNLLVDCGVAGFRVDAAKHMWPSDLEDIYSQVNNLRTDHGFAPGSRP
FYYQEVIDLGGEAIHNTDYTGFGRITEFKYSAEIGNAFRGNNPIKYLWNFGEDWGFVYNG
DALVFVDNHDNQRGHGAGGASILTYKEPKLYKMAVAFVLAYPYGYPRVMSSFDFSNSDQG
PPQDGDGNILSPIIYNDNTCGNGWICEHRWRQIYNMVGFRNVVAGTGVNDWWDNSDKQIA
FCRGGRGFIAFNDQYNVDLKETLQTCLPAGIYCDIISGSKVGNNCSGKSVIVDGSGRAYI
EILYAESDGVLAIHAESKL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctttggtttgcgtgtggcttctggtcttagtggtggtcgtccacagtcagaaa
gaccccaatgtgtgggctaacagaagcgccatcgttcatcttttcgaatggaaatttaac
gacatcgccgatgaatgtgagagattccttgctccgaatggttacgctggtgttcaggta
tctcctgtccaggagaacgttatagtgagttcgcctaaccgaccctggtgggagaggtac
caacccatttcttataaaattgtgacccgttcgggagatgaagcggctttcaggtccatg
gttcgtcgctgcaatgacgttggtgtcagaatatacgtagatattgttatcaatcatatg
accggcgatcatgccactgctgttggtgtgggcggatcaactgccgatacttacaatctg
cagtatccggctgtgcccttcggacccaacgacttcaaccaacctcagtgtggcatcgac
aattacgaggacccaaataatgttcgaaattgcgaacttgtaggtcttcacgatttgaac
caaggaagtggctatgtacgagaaaagattattggttttcttaatcttctggtggattgt
ggagtggcaggatttagggttgatgctgccaagcacatgtggcccagtgatctggaagac
atctacagtcaggtgaacaatctacggaccgaccatggttttgcccctggaagcagacct
ttctactatcaggaagttattgacctgggtggtgaagcaatacacaacacagattatact
ggttttggccgtatcaccgagttcaaatacagtgctgagattgggaatgctttccgagga
aacaatcctatcaagtatctctggaactttggtgaagactggggatttgtctataatgga
gatgctcttgtttttgtggacaaccatgacaatcaaagaggtcacggagctggaggtgca
agtattctcacctacaaggaacccaaactgtataagatggcggttgcttttgtattggcc
tatccatatggctacccacgtgtaatgtctagctttgacttcagtaactctgatcaaggc
cctccccaagatggtgatggcaacatcctgtcaccaattatctacaatgacaacacttgt
ggtaatgggtggatctgtgagcatcggtggagacagatctacaacatggttggcttcagg
aatgttgtggcaggaactggtgtgaatgattggtgggacaactcagacaagcaaattgca
ttttgcagaggaggcagaggcttcattgccttcaatgaccagtataatgtagacttgaag
gaaacattacaaacgtgcctccctgcaggtatctactgtgacatcatctcaggttcaaag
gttggaaacaactgtagtggaaagtctgttattgttgacggttctggaagagcttacatt
gaaatcctgtatgccgagtctgatggcgtcctagccattcatgctgagtcaaagctgtaa

DBGET integrated database retrieval system