Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2695
Help
Entry
Aaci_2695 CDS
T00985
Name
(GenBank) ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
aac
Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
aac00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
Aaci_2695
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
aac03011
]
Aaci_2695
Ribosome [BR:
aac03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
Aaci_2695
Bacteria
Aaci_2695
Archaea
Aaci_2695
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID:
ACV59699
UniProt:
C8WTV7
LinkDB
All DBs
Position
complement(2769104..2769463)
Genome browser
AA seq
119 aa
AA seq
DB search
MITKPNRNEARKRRHVRVRAKVFGTPERPRLNVFRSNKHIYAQLIDDTIGHTIAAASSLE
KGFEGNGGNVEGARQVGRMIAERALAKGYKKVVFDRGGYLYHGRVRALADAAREAGLDF
NT seq
360 nt
NT seq
+upstream
nt +downstream
nt
gtgattacgaagccaaaccgcaacgaagcgcgcaaacggcgtcacgtgcgggttcgggcc
aaggtcttcggaacgcccgaacggccgcggctgaacgtgttccggtcgaataagcacatc
tacgcgcagctcattgacgacaccattgggcacaccatcgcggctgcgtcgagcctcgag
aagggcttcgagggcaacggcggtaatgtggaaggtgcgcggcaggtcggccgcatgatc
gcggagcgcgcgcttgccaagggatacaagaaagtcgtcttcgatcgcggcggatacctc
tatcacgggcgggtacgggcgcttgcagacgccgcgcgtgaagcggggctcgatttctaa
DBGET
integrated database retrieval system