Acetobacter aceti: A0U92_06295 Help Entry A0U92_06295       CDS       T04735                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aace  Acetobacter aceti Pathway aace01100   Metabolic pathways aace01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aace00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A0U92_06295    00074 Mycolic acid biosynthesis     A0U92_06295   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A0U92_06295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L12_N DUF5783 Motif Other DBs NCBI-ProteinID:  AQS84449 UniProt:  A0A1U9KFF5 LinkDB All DBs Position 1404670..1404909 Genome browser AA seq 79 aa AA seqDB search MSEIADKVKKIVVEHLGVEESKVTPDASFIDDLGADSLDTVELVMAFEEAFNVEIPEDAA EKIATVKDAIDYIEAQKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaatcgctgacaaggttaagaagatcgtcgtcgagcacctcggcgttgaagag agcaaggtgacaccggatgcgtcgttcatcgacgatctgggcgcagacagcctcgacacg gtcgaactggtgatggcgtttgaagaagctttcaacgtggaaatcccggaagacgcagcc gagaagatcgctaccgtgaaggacgcgattgattacatcgaggcacagaaagccgcttga

DBGET integrated database retrieval system