Acetobacter aceti: A0U92_16550 Help Entry A0U92_16550       CDS       T04735                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aace  Acetobacter aceti Pathway aace01100   Metabolic pathways aace01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aace00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A0U92_16550    00074 Mycolic acid biosynthesis     A0U92_16550   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A0U92_16550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 RE_HaeII Motif Other DBs NCBI-ProteinID:  AQS86094 UniProt:  A0A1U9KJV6 LinkDB All DBs Position 3650366..3650617 Genome browser AA seq 83 aa AA seqDB search MSETVQDVSALIINKLLANPKVPRDISGASKIVEDLAFDSLAVMNFVMEIEDELDVSVPL DRLAEIRTIDDLAECIVSLKKGN NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagtgaaacggttcaggacgtctcggctctgatcatcaacaagcttcttgccaatccc aaagtcccccgtgacatcagtggagccagcaagattgttgaagacctggcgttcgactcg cttgctgtcatgaatttcgtcatggaaatcgaagacgagctggacgtgtccgtgcctctc gaccgtctggccgagatccgtacgatcgacgaccttgccgaatgcatcgtctccctgaag aagggcaactga

DBGET integrated database retrieval system