Alicyclobacillus acidoterrestris: K1I37_18440 Help Entry K1I37_18440       CDS       T08106                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aaco  Alicyclobacillus acidoterrestris Pathway aaco01100   Metabolic pathways aaco01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aaco00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K1I37_18440 (acpP)    00074 Mycolic acid biosynthesis     K1I37_18440 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K1I37_18440 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 jr-ZPR1 Phage_holin_T Motif Other DBs NCBI-ProteinID:  UNO48615 UniProt:  T0DMT4 LinkDB All DBs Position complement(3744216..3744467) Genome browser AA seq 83 aa AA seqDB search MMSLTKAQIEEKVKNVVCNQLQVDASEVKADSLFVDDLGADSLDLTELAVAFEDEFDIEI PEADFGQLSTVAGVVDYIQGRLS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgatgtcattgacgaaggcgcaaatcgaagaaaaggtaaaaaatgtcgtgtgcaatcaa ctgcaagtggatgcttccgaggtgaaggcagacagtctgtttgtcgatgatttgggtgca gattcgctggacttgactgagctcgctgtcgcttttgaggacgagtttgacatcgaaatt ccggaagcggactttggccaactgtcgactgtggctggtgtcgtcgactacattcagggt cgcctttcgtaa

DBGET integrated database retrieval system